(data stored in ACNUC7421 zone)

EMBL: CP002293.PE427

CP002293.PE427       Location/Qualifiers
FT   CDS_pept        485996..486880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0447"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gwc:GWCH70_0294 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73283"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN2"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0294"
FT                   /protein_id="ADP73283.1"
FT                   /translation="MLTIRVNPEELETVAKHVPDAEDGCSRARTSLSWELPSLVMEIPG
FT                   IGSAAIQELTDELLHWLRRYEEKLNEAEELLYRTAAAIRQADQTLADNMKEFGLELLGW
FT                   YDLQRVFGEYDPITGERISGWDRLVAGGMLLLSVIPPAKGAGVAGKAVIKGAKAAETAA
FT                   DVSKWISKTRNVLNVNKIKGALQTIYHQVIKGPITETIRSFKHQWENFLENVGSVLQGP
FT                   QLAADGVEVVPSGRMIGIAEESASSVRVSMSQAGDEVVGKGIGKGKNESPRNKPGVVSE
FT                   SFKFDRSLQSKQN"
     atactgacga ttcgagtcaa tccggaagag ctggaaacgg tagcaaagca tgtccccgat        60
     gccgaagacg gctgctcccg tgcgcggacc tcgctttcct gggaactgcc ctctttagtg       120
     atggagattc cgggcatcgg ttctgccgct attcaggagc ttacagacga actgcttcat       180
     tggctccggc gctatgaaga aaagctgaat gaagcggagg aattactgta tcggacagct       240
     gcggccatca gacaggcaga tcaaacgctc gccgataaca tgaaagaatt tggtctggag       300
     cttcttggct ggtatgactt gcagcgggtg tttggggaat acgacccgat tactggagaa       360
     cggatatccg gatgggaccg cctagttgcg ggaggaatgt tattgttgtc ggtcattcct       420
     ccagccaaag gagcgggtgt cgccggtaaa gccgtgatca aaggagcgaa agcggcggaa       480
     acagcagcgg atgtttcgaa atggatttcg aaaacgagaa acgtcctgaa tgttaataaa       540
     atcaaagggg ccttacaaac gatttatcac caagtcatca aaggaccaat caccgaaaca       600
     attcggtcgt tcaaacatca atgggagaac tttctcgaaa atgttggctc tgtcctacag       660
     ggaccgcagc tagccgccga tggagttgaa gtggtgccaa gtgggcggat gataggaatc       720
     gctgaagaat ccgccagctc ggtgcgcgtt tcgatgagtc aagccgggga tgaggtggtt       780
     ggtaaaggga taggtaaagg aaaaaatgaa agtcctagga ataagcctgg agtagtgagt       840
     gaaagtttta aattcgatag aagtcttcaa agcaaacaaa actaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page