(data stored in ACNUC7421 zone)

EMBL: CP002293.PE428

CP002293.PE428       Location/Qualifiers
FT   CDS_pept        486880..487230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0448"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: bcg:BCG9842_B0470
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73284"
FT                   /db_xref="GOA:A0A0F6BIN3"
FT                   /db_xref="InterPro:IPR003060"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN3"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADP73284.1"
FT                   /translation="MYNKGSIGIIPKEIRDKLVGKKFNSFDDFRKEFWKCVANSSYAKE
FT                   FRSRNIARMLEGNAPIAPKAEHYGKLKSYILHHKQPIERGGEVYNLDNMIITSPRMHQI
FT                   ILDPAYHFGKKG"
     atgtacaata aaggttccat tggaattatt ccaaaagaga ttcgagataa acttgttgga        60
     aaaaaattta attcttttga tgactttaga aaagagtttt ggaaatgcgt tgcaaattcg       120
     agttatgcaa aagaatttag gagtagaaat atcgcacgaa tgttagaagg aaacgcacct       180
     attgctccaa aggctgaaca ttacggcaag cttaaatcat atatacttca ccataaacag       240
     cctattgaga gaggtggaga agtttataat cttgacaata tgattattac atcacctaga       300
     atgcaccaaa taattttaga ccctgcatac cactttggta aaaaaggttg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page