(data stored in ACNUC7421 zone)

EMBL: CP002293.PE429

CP002293.PE429       Location/Qualifiers
FT   CDS_pept        487254..487466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0449"
FT                   /product="Colicin immunity protein/pyocin immunity protein"
FT                   /note="PFAM: Colicin immunity protein/pyocin immunity
FT                   protein; KEGG: bsu:BSU06800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73285"
FT                   /db_xref="GOA:A0A0F6BIN4"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN4"
FT                   /inference="protein motif:PFAM:PF01320"
FT                   /protein_id="ADP73285.1"
FT                   /translation="MENKLSKEELIELVKKICDPKLSDEEVSEYIDILEKNVPHPAPSD
FT                   LIFWNDEELSPEEIVEIALNYKDRN"
     atggaaaata aactatctaa agaggaattg attgaacttg taaaaaaaat atgcgatcct        60
     aaattatctg atgaagaggt aagtgaatat attgatattt tagaaaaaaa tgttcctcat       120
     ccagctccaa gtgacctaat tttttggaat gatgaagaat tatcaccaga ggaaatagta       180
     gaaatagctt taaattataa agatcgtaat taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page