(data stored in ACNUC7421 zone)

EMBL: CP002293.PE430

CP002293.PE430       Location/Qualifiers
FT   CDS_pept        487724..488617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi01315 YeeF"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN5"
FT                   /inference="similar to AA sequence:KEGG:BLi01315"
FT                   /protein_id="ADP73286.1"
FT                   /translation="MSIIPPAKGAGVAGKAGIKGLKAAETAAEVLKWISKTRNVLNVNK
FT                   IKGALQTIYYQVIKGPITATIRSFKQQWEQLLENVGSVLMGPQPALAGIGPARGVWMSG
FT                   AEREVKETTMNMIGKTGDEVVGKGTGKSTPTNTHTKVNYGEHYTRDGRRKVLKPNVEYT
FT                   TPAGYTYRTDDKGRIVNAEGKLNLGEAKRNNHAQKVAGREDRLLDDEGGHLIATIFKGS
FT                   GSLDNLVPMNGNLNKGEWKKLENMWRKQLEKGKLVEVKIKPVYKGESQRPVSFDIEYKI
FT                   GKGKWQYKEFQNKPGG"
     ttgtccatca ttcctccagc caaaggagca ggcgtcgccg gtaaagcagg gatcaaagga        60
     ttgaaagcgg cagaaacagc agcggaggtt ttgaaatgga tctcgaaaac gagaaacgtc       120
     ctgaatgtta ataaaatcaa aggggcttta caaacgatct attaccaggt catcaaaggg       180
     cctatcaccg caacgatccg ctcgttcaaa cagcaatggg aacaacttct cgaaaatgtt       240
     ggctctgtcc tgatgggacc acagccagcc ttggcaggaa tcggtccggc ccgcggtgtg       300
     tggatgagcg gagccgagag ggaagtaaaa gaaacgacga tgaatatgat tggcaaaact       360
     ggggatgagg tggttggtaa gggcacgggt aaatctacac caacgaatac tcatactaag       420
     gttaactatg gagagcatta caccagagac ggacggagaa aggtacttaa accaaatgta       480
     gagtatacaa ctcctgcagg atacacttat agaaccgatg acaaaggacg tattgtcaat       540
     gctgaaggta aacttaactt gggggaggcc aaacgaaata atcatgccca gaaggtggcg       600
     ggtagagaag atagactact agatgatgaa ggtggacatt tgatagcaac tatatttaaa       660
     ggttcgggta gccttgacaa tcttgtacct atgaatggta acctgaataa aggtgagtgg       720
     aagaaactcg agaacatgtg gaggaaacaa cttgaaaaag gaaaactggt tgaagtgaag       780
     ataaaacctg tttataaagg tgagtcacaa agaccggtaa gttttgacat agaatataaa       840
     ataggaaagg gtaagtggca atacaaagaa ttccaaaata aacctggagg ttaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page