(data stored in ACNUC7421 zone)

EMBL: CP002293.PE432

CP002293.PE432       Location/Qualifiers
FT   CDS_pept        489974..490876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73288"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0423"
FT                   /protein_id="ADP73288.1"
FT                   /translation="MKQKKLLYRTAAAISQADQTLADNMKEFGMELSGWYDLQRVFGEY
FT                   DPVTGERISVGDRLFAGGMLLLSIIPPAKGAGVAGKAGIKGLKAAETAAEVLKWISKTK
FT                   NVLNVDKIKGAFQTIYHQVIKGPITETIRSFKKQWENFLENVGSVLMGPELAIDGVGAV
FT                   PSGRMIGIAEESASSVRISMSQVGGEVGKEAGGAVYKGTGKLSRRDQLLNQVTNKKLRN
FT                   TINEMFRPTATVGDGSLAAAVRLEAKKGILTGGKSHIQKAKERIRNLENILMKENLDPK
FT                   EREIANDLLIELKRALNGK"
     atgaagcaga agaaactgct gtaccggact gccgcggcaa taagccaggc agaccaaacg        60
     cttgccgata acatgaaaga attcggtatg gaacttagtg gctggtatga cttgcagcgg       120
     gtgtttggag aatacgaccc agtgactgga gaacggattt cagtaggaga ccgtctgttt       180
     gcggggggaa tgctattgtt gtccatcatt cctccagcca aaggagcagg cgtcgccggt       240
     aaagcaggga tcaaaggatt gaaagcggca gaaacagcag cggaggtttt gaaatggatc       300
     tcgaaaacga aaaacgtcct gaatgttgat aaaatcaaag gggctttcca aacgatctat       360
     caccaagtca tcaaaggacc aatcaccgaa acaatccggt cgtttaaaaa acaatgggag       420
     aactttctgg aaaatgttgg ttctgtcctg atggggccgg agctagccat cgatggagtt       480
     ggagcggtac caagtgggcg gatgatagga atcgctgaag aatccgccag ctcggtgcgc       540
     atttcgatga gtcaagtcgg aggtgaagta gggaaagaag cggggggtgc cgtatataag       600
     gggacaggaa agcttagcag gagagatcaa cttttaaatc aagttacaaa taaaaagtta       660
     cggaatacta tcaacgaaat gtttcgtcca actgcgacag taggtgatgg aagtcttgca       720
     gcagcagtaa ggctagaagc taaaaaagga attttaacag gaggaaagtc tcatattcaa       780
     aaggcaaaag aaagaataag gaacttagaa aatattttaa tgaaagagaa tttggatcca       840
     aaggaaagag aaatagcaaa tgatttatta atagaattaa agagagcttt aaatggaaaa       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page