(data stored in SCRATCH zone)

EMBL: CP002293.PE434

CP002293.PE434       Location/Qualifiers
FT   CDS_pept        491469..492650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0454"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: gtn:GTNG_0322
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73290"
FT                   /db_xref="GOA:A0A0F6BIN9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN9"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73290.1"
FT                   /translation="MSKSIPNVDWANQLESAIRQFVKEKLELIMREEIKNFLEIAQAET
FT                   SNMRNGYYQRTLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWRKRSSRCIKVAGV
FT                   RGNWQVYRTNSRKCLFSRDDQPYYRCRKGRHRKMAPSSTAQALFGLIFGRFVCETSPRY
FT                   GRERSHLCGVKGNEEGYREILDFFVGGQESAYVWQEILQQLYNRGVKEVLLGVFDGLPG
FT                   LEEAFQAVYPKTGVQRCVVHKVRSTLSRVQIHFRDTLSILHYTKFLTVPEKEMRYMNKE
FT                   EFVKLLHQSIIKENRNFYRDIFNNTDINEVTDPYWKEALMFYSELSDKNKEILFKIIEQ
FT                   VEVDAVSNILGVLDGVVSIGEEDIEFKVTINDNNEPINGDLQDLFLEYDEENR"
     atgtctaaaa gtataccgaa tgtcgactgg gcaaatcaac tggaaagtgc catccgtcag        60
     tttgtaaaag aaaaattaga actgattatg cgggaagaaa tcaaaaattt cctcgaaatc       120
     gcacaggcgg aaacatccaa tatgagaaac ggctactacc aacgaacgct ggatacgcaa       180
     tatggtcgta ttgaaggtct tttggtccca agagaccgaa atggggaatt tcaaacgcag       240
     ctgtttgccc cttatcaacg acacaccggc tggaggaagc gatcatcaag atgtatcaaa       300
     gtggcaggag tacgcgggaa ttggcaagtt tatcgaacga attctaggaa atgcctattt       360
     tcccgcgacg atcagccgta ttaccgatgt cgtaaaggaa gacatcgaaa aatggcgcca       420
     tcgtccactg cacaagcgtt attcggtctt atatttggac ggtttgtatg tgaaacttcg       480
     cctcgatacg gtagagaaag aagtcattta tgtggtgtta aggggaatga agaggggtat       540
     cgtgaaattc ttgatttctt cgtaggagga caagaaagcg cctatgtatg gcaggagatt       600
     cttcaacaac tatacaacag aggcgtaaaa gaagtgctgc ttggcgtatt cgatggacta       660
     ccggggctgg aggaagcctt tcaggcggtt tatccgaaaa ccggcgtgca gcgttgtgtc       720
     gttcacaaag tccgtagcac actcagccgt gttcaaatcc atttcagaga taccctatct       780
     atcttgcatt acacaaaatt cttgacagta cctgagaagg agatgagata tatgaataaa       840
     gaagagtttg ttaaactttt acatcagtca attataaaag aaaatcgtaa tttttatcga       900
     gatatattca ataatactga tattaatgaa gttacagacc cctattggaa agaagcattg       960
     atgttttatt cagaactatc agataaaaat aaagaaatat tgtttaaaat aatcgaacaa      1020
     gtagaagtgg atgctgtatc taatatttta ggggtgttag atggggtagt atcaatagga      1080
     gaagaggata ttgagtttaa agtgacaatt aacgataata atgaaccaat taatggagat      1140
     ttacaagacc tatttttgga gtatgatgaa gagaataggt aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page