(data stored in ACNUC7421 zone)

EMBL: CP002293.PE437

CP002293.PE437       Location/Qualifiers
FT   CDS_pept        497362..498258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0459"
FT                   /product="manganese containing catalase"
FT                   /note="PFAM: manganese containing catalase; KEGG: manganese
FT                   containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73293"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP2"
FT                   /inference="protein motif:PFAM:PF05067"
FT                   /protein_id="ADP73293.1"
FT                   /translation="MFTRIDKLAIELPEPKYADANAAAAVQELLGGRFGEMSTLNNYLF
FT                   QSFNFRQKKKLKPFYDLIASITAEEFGHVELVSTAINLCLTGSTHPGDPDIAPMRNAVD
FT                   KRNTYHFIATAQTAFPGDSMGKAWTGDYVFSSGNLILDLLHNFFLECGARANKMRVYEM
FT                   TDHPVAREMVGYLLVRGGVHIIAYAKALEVATGVDVTKMLPIPNLDNKKFDVARKFEEQ
FT                   GVHRRLYTFSDKYYKDIAQIWKGTHPLDGQPLEVIEGIPQGGPVPELAEIPEAFAPGVS
FT                   AEDFFEIAKRLQRSAGL"
     ttgtttacaa gaattgataa actggccatt gagctgccgg agccgaaata cgctgatgca        60
     aacgcagcag cggcagtaca ggaattgctc ggcgggcgtt ttggagaaat gtcaacatta       120
     aataattatt tgtttcaatc gtttaatttc cggcaaaaga aaaaacttaa gccgttttat       180
     gatttgattg ccagcatcac cgctgaagag ttcgggcatg tggagcttgt gtcgacagct       240
     attaatttat gtctcactgg ttccactcac ccgggagatc ccgatattgc tccaatgaga       300
     aacgcggtgg ataaacggaa tacgtatcat tttatcgcga cagcgcaaac agcgtttcct       360
     ggagactcga tgggaaaagc gtggacaggg gattatgtgt ttagcagcgg gaatttgatt       420
     ctcgatttgc tgcataactt tttccttgag tgcggagcgc gggcgaataa aatgcgtgtt       480
     tatgaaatga cagaccatcc ggtggcgcgc gaaatggtag gatatttgct cgtccggggc       540
     ggtgttcata tcattgctta cgcgaaggcg ctcgaagtag ccacaggggt cgatgtcacg       600
     aagatgcttc cgattccaaa tttagataat aagaaatttg acgtcgcgcg gaaatttgaa       660
     gaacaagggg tccatcgccg gctttatacg tttagtgaca aatattataa ggatattgcc       720
     caaatttgga aaggaacaca tccgcttgat ggacagccgc tagaagtgat tgaagggatt       780
     ccacagggag ggccggttcc agagttggcg gaaattccag aagcatttgc tccaggagta       840
     tcagcagaag actttttcga aattgccaaa cgcctgcaac gatctgcagg attataa          897
//

If you have problems or comments...

PBIL Back to PBIL home page