(data stored in ACNUC7421 zone)

EMBL: CP002293.PE438

CP002293.PE438       Location/Qualifiers
FT   CDS_pept        complement(498465..499931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0460"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bld:BLi04113 KatA; PFAM: Catalase related
FT                   subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73294"
FT                   /db_xref="GOA:A0A0F6BIP3"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP3"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADP73294.1"
FT                   /translation="MADTKKLTTSWGAPVGDNQNSITAGNPGPTLIQDVHLIEKLAHFN
FT                   RERVPERVVHAKGAGAHGYFEVTNDMSKYTKAKVFNGVGKRTPVFVRFSTVAGELGSAD
FT                   TVRDPRGFAVKFYTEEGNYDIVGNNTPIFFIRDAIKFPDFIHTQKRDPRTHLKNPTAMW
FT                   DFWSLSPESLHQVTYLFGDRGIPLTYRHMNGYGSHTFKWVNEKGEAVWVKYHFKTNQGV
FT                   KNMDPELAVKIAGENPDYHTEDLYNAIEKGDYPSWTLYVQIMPLEDAKTYRFNPFDVTK
FT                   VWSHKDYPLIEVGRMVLNRNPENYFAEVEQATFSPGNLVPGVEPSPDKMLQARLFAYAD
FT                   AHRYRVGVNHNLLPINRPRVEVNNYQRDGFMRFDNNGGGSVNYEPNSFGGPTEVPEHKT
FT                   TPFPVSGVAESVPYDDDDHYTQAGDLYRLMSEEEKARLVKNIVESLKQVTKEEIKLRQI
FT                   RHFYKADPDYGRRVAEGLGLQIPDDVTTNA"
     atggcagata caaaaaagct cacaactagt tggggagcac ctgttggcga taaccaaaac        60
     tcgataacgg ccggcaatcc tggcccgaca ttaatccaag acgtacatct tatcgaaaaa       120
     ttagcacact tcaatagaga acgtgtccca gaacgtgttg tccatgcgaa aggcgctggt       180
     gcgcacggct atttcgaagt aacaaacgat atgtcgaaat acacaaaagc gaaagtgttt       240
     aacggtgttg gcaaacgcac gcctgtattc gtccgcttct ctactgtcgc cggtgaattg       300
     ggatctgcag atacagtccg cgacccgcgc ggttttgccg tcaaatttta taccgaagaa       360
     ggaaactatg acatcgttgg caacaacaca ccgattttct tcattcgtga tgcgattaaa       420
     ttcccggatt ttatccatac acaaaaacgt gacccacgca cccatttgaa aaatccgaca       480
     gcaatgtggg atttctggtc tttatctccg gaatctttgc accaagtcac ttatttattc       540
     ggggatcgcg gcatcccatt aacataccgc catatgaacg gatacggaag ccatacattc       600
     aaatgggtga atgaaaaagg cgaagcggta tgggtaaaat accactttaa aacaaaccaa       660
     ggcgtgaaaa acatggatcc ggaactagcg gttaaaatcg ccggagaaaa tccggattac       720
     catacggaag atttatataa cgccatcgaa aaaggcgact atccatcttg gacattatat       780
     gtgcaaatta tgccgttaga agacgcaaaa acataccgtt tcaatccatt tgatgtcaca       840
     aaagtttggt cacataaaga ttatccgtta attgaagtcg gccgtatggt attaaaccgc       900
     aatccagaaa attattttgc cgaagtcgaa caagcgacat tctctcctgg aaaccttgtt       960
     cctggcgttg aaccatcgcc ggataaaatg ttgcaagccc gtttgttcgc ttatgcggat      1020
     gcgcaccgtt accgcgtcgg cgtgaaccat aacttgcttc cgatcaaccg cccgcgcgtg      1080
     gaagtaaaca attatcaacg tgacggcttc atgcgctttg acaataatgg cggcggttcg      1140
     gtcaactacg aaccaaacag cttcggcgga ccgacagaag tgccagaaca taaaacgacc      1200
     ccattcccgg tatccggcgt ggcagaaagc gtgccatatg acgacgatga tcattatacg      1260
     caagcaggcg acttataccg tctcatgagc gaagaagaaa aagcgcgcct tgtgaaaaac      1320
     attgtcgaat cattgaaaca agtaacaaaa gaagaaatta aacttcgcca aatccgccac      1380
     ttctacaaag cagaccctga ctacggccgc cgcgttgccg aaggtcttgg cttgcaaatc      1440
     ccggatgacg tgacaacaaa cgcataa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page