(data stored in ACNUC7421 zone)

EMBL: CP002293.PE439

CP002293.PE439       Location/Qualifiers
FT   CDS_pept        complement(500063..500962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gtn:GTNG_2993 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73295"
FT                   /db_xref="GOA:A0A0F6BIP4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP73295.1"
FT                   /translation="MIDIKQLKYFATIVEEGQITKAAKKLHMAQPPLSQQLKQLEETLG
FT                   ITLLERNGRKLELTAPGKILYKKAKQLLHQLEDAILEVREMEDGTSGVLSIGCVKSCFY
FT                   YLSEIIRPFHQLFPNVKFHLREGDSFSICELLRQREIDIGIVRLPIDSHHYEMIHLPND
FT                   PYIAVFPRQWNISKPYVYMKEFADIPLLLLHRIQGKGQYELVINECRRHGFEPKIICEC
FT                   PDATILLSLVSKGIGATIVPKSTVSFFCLPDICVLDIADSSIYAEAAAIIEKNRYIPKS
FT                   THHFLTILKEKFSNKIKN"
     atgattgata taaaacaatt aaaatatttt gcaacaattg tggaagaagg acaaattacc        60
     aaagcggcta aaaagctgca tatggcacag ccaccgttaa gccaacagct aaaacagctg       120
     gaggaaactc tgggaattac gttgttagaa agaaatggta gaaaactgga attaacagcg       180
     ccagggaaaa ttttatataa aaaagcaaaa cagctgcttc atcaattaga agacgctatt       240
     ttagaagtcc gcgaaatgga agacggaaca agtggtgtgc tatctatcgg ttgtgttaaa       300
     tcatgctttt attatttatc agaaatcatc cgaccttttc atcaattatt tccaaatgta       360
     aagtttcatt tacgtgaagg agatagtttt tccatctgcg agttattgag gcagcgggaa       420
     attgatattg gaatcgtccg ccttcctatc gattcgcatc attacgaaat gattcatctg       480
     ccaaacgatc cttatattgc tgtttttcca aggcaatgga acatttctaa gccgtatgtg       540
     tatatgaaag aatttgctga tattcctctt cttctccttc accgtattca aggaaaggga       600
     caatacgaac ttgtcattaa tgaatgccgg cgccacggct tcgaaccaaa aatcatttgc       660
     gagtgccctg atgcaacgat tttgctctcc ctcgtttcca aagggatcgg agccactatt       720
     gttccgaaat cgaccgtttc ttttttctgc cttccagaca tttgtgtact ggatattgct       780
     gattcttcca tttacgcaga agcagcagca attattgaaa aaaatcgtta tattccaaaa       840
     agcactcatc actttttaac aattcttaag gaaaaattta gcaataaaat aaaaaactaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page