(data stored in ACNUC7421 zone)

EMBL: CP002293.PE44

CP002293.PE44        Location/Qualifiers
FT   CDS_pept        54950..55324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0044"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: gwc:GWCH70_0043 endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72900"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ9"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADP72900.1"
FT                   /translation="MEKVETNNAPQAIGPYSQGIVVNNMFYSSGQIPLTPEGEMVQGDI
FT                   KAQTHQVFQNLKAVLEAAGASLDTVVKTTVFLKSMDDFAAMNEVYSQYFTNHKPARSCV
FT                   EVARLPKDALVEIEVIALIR"
     atggaaaaag tagaaacaaa taacgcgccg caagcgatcg gtccatattc gcaaggaatt        60
     gtcgtcaaca acatgtttta cagctctggg caaattccgc ttactcctga gggcgagatg       120
     gtgcaagggg atatcaaagc gcaaacccat caggtgtttc aaaatttaaa ggcggtgctg       180
     gaagcggcgg gagcgtcact ggatacggtt gtgaaaacaa cggtattttt aaaaagcatg       240
     gatgattttg cggcaatgaa tgaagtgtac agccaatact ttaccaatca taaaccggcg       300
     cgttcttgcg tggaagtggc gagactgccg aaagacgcgc tagtggaaat cgaagtcatc       360
     gcgctcattc ggtaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page