(data stored in ACNUC7421 zone)

EMBL: CP002293.PE440

CP002293.PE440       Location/Qualifiers
FT   CDS_pept        501168..502643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0462"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, oxygenase
FT                   subunit"
FT                   /note="KEGG: gtn:GTNG_2992
FT                   4-hydroxyphenylacetate-3-hydroxylase; TIGRFAM:
FT                   4-hydroxyphenylacetate 3-monooxygenase, oxygenase subunit;
FT                   PFAM: 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73296"
FT                   /db_xref="GOA:A0A0F6BIP5"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012687"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP5"
FT                   /inference="protein motif:TFAM:TIGR02309"
FT                   /protein_id="ADP73296.1"
FT                   /translation="MPAKTGKEYIERLKKAKSNVYIHGERVEDVTEHPAFKNVIQSMAR
FT                   LYDLQYEKQEKMLYTSPTTGNKVSITYIQPTTKEELIARREATQEWARTSAGMMGRSPD
FT                   YLNAEVMAMGVANDLFAEDDPMFAENARNYYEYARENDISLTHTLIHPQMNRSKAQHEQ
FT                   KDANVPLHLVEKRKDGIIVEGIRLLATQGGITDEILVFPSTVKKSGSGEDPYSLAFAIP
FT                   NNTPGVKFICREAFDYGKSHWDHPLGSRFEEGDAIVSFENVFVPWERVFICGNSSICNR
FT                   TFRETNAVVHMSHQVVAKNIVKTEFILGVVLCIMDAIGIEQFQHVKDKGTEIMLVLETM
FT                   RSHLYRAEHNAKLDKWGTMTPDFAALDAARNWYPRIYPRLAEIVRILGASGLMAIPAEA
FT                   DFNNEEIGAIVRRAMQGANIDGYERVQLFRLAWDMTMSAFGSRQTHYEYYFFGDPIRMG
FT                   MTYFDNYEKDYYKNLIYEFLGTPKLAHVSVNTH"
     atgccggcaa aaacaggtaa agaatatatc gaacgtttaa aaaaagcgaa aagtaatgtc        60
     tatattcatg gagaaagagt ggaggatgtt accgagcatc cagcgtttaa aaatgttatc       120
     caatcgatgg cgcgccttta tgatcttcaa tacgaaaagc aggaaaaaat gttatataca       180
     tcaccgacaa cgggaaacaa agtgagtata acgtatatcc agcctacgac gaaggaagag       240
     ttgatcgcca gacgggaagc aacgcaagaa tgggcgcgca cttccgcagg aatgatgggg       300
     cgttcacctg attacttgaa cgcggaagtg atggcgatgg gagtggccaa tgacttgttt       360
     gctgaagatg acccgatgtt tgctgaaaat gcgagaaatt attatgaata tgcacgtgaa       420
     aacgatatta gccttacaca tacgctcatt catccgcaga tgaaccgttc aaaagcccaa       480
     catgaacaaa aagatgcgaa tgtccctttg catttagtag aaaaaaggaa agacggcatt       540
     attgttgagg gtattcgtct attggcgacg caaggtggaa ttactgacga aattttagta       600
     ttcccgtcca ctgtcaaaaa atcgggatcg ggtgaagacc catactcgct agcgtttgcc       660
     attcccaata atactccagg tgtaaaattt atttgccgtg aagcgtttga ctacggcaaa       720
     agtcattggg atcatccgtt aggttcgcgt tttgaagaag gggatgccat cgtttcattt       780
     gaaaacgttt ttgttccgtg ggaacgcgtg tttatttgcg ggaattcttc catttgcaat       840
     cggacgttcc gtgaaacgaa tgcggttgtt catatgtctc atcaagtggt tgccaaaaat       900
     attgtgaaaa cagagtttat tcttggtgtt gttctttgta ttatggatgc aattggtatt       960
     gagcaattcc aacatgtcaa agacaaagga acagaaatta tgttagtgct cgagacaatg      1020
     cgcagccatt tatatcgggc ggaacataat gccaaattag acaaatgggg aacaatgact      1080
     ccagattttg cggcacttga cgcagcgaga aactggtatc cgagaattta tccgcgtcta      1140
     gcggaaattg tgcgcattct tggcgcctca ggattgatgg cgattccggc agaagctgac      1200
     tttaacaatg aggaaatcgg agcgattgtg cgaagagcga tgcaaggtgc gaatatcgac      1260
     ggatatgaac gtgtgcaact attccggttg gcatgggata tgacaatgag cgcctttgga      1320
     agccgacaaa cgcattatga atactacttt tttggtgatc caatccgtat gggaatgact      1380
     tattttgata actatgaaaa agattactat aaaaatttga tttacgagtt tttaggaaca      1440
     ccgaaacttg ctcatgtttc tgtcaatact cattaa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page