(data stored in ACNUC7421 zone)

EMBL: CP002293.PE442

CP002293.PE442       Location/Qualifiers
FT   CDS_pept        503959..504471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0465"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gtn:GTNG_2979 flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73298"
FT                   /db_xref="GOA:A0A0F6BIP7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP7"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADP73298.1"
FT                   /translation="MAVIMIKQGVKNVDDRTFRNAMGKFATGVTVITSSLNGQVRGMTA
FT                   NAFMSVSLNPKLVLISVGEKAKMNSVIQQTGKFAVNILSDQQQALSMLFAGQLKEERNV
FT                   EFAWMDGHPILPDSLANILCDVDISYIAGDHTLYVGKVTDIYMKEGDPLLFFAGKYCTV
FT                   AGLANGG"
     ttggcagtga tcatgataaa acaaggagtg aagaacgtgg acgatcgtac atttagaaat        60
     gcgatgggga aatttgcaac tggtgttact gtcattacat cctctttaaa cggccaagtg       120
     cgcgggatga cagcaaatgc attcatgtca gtgtcattaa atccgaagtt ggttcttatt       180
     tctgttggcg aaaaagctaa aatgaattca gtcatccaac aaaccggaaa atttgctgtc       240
     aatattttat ctgatcaaca acaagcactc tctatgttat ttgctggaca attaaaagaa       300
     gagcggaatg tggaatttgc ttggatggat ggtcatccga tcttaccaga ttccttggcc       360
     aatattttgt gtgatgttga tatctcatat attgcaggag accatacgtt atatgttggc       420
     aaagtaacgg acatttacat gaaagaagga gatccgctgt tattttttgc agggaaatac       480
     tgcactgtcg ctggcctagc aaatggggga tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page