(data stored in ACNUC7421 zone)

EMBL: CP002293.PE447

CP002293.PE447       Location/Qualifiers
FT   CDS_pept        507657..509171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0470"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: gtn:GTNG_2986
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73303"
FT                   /db_xref="GOA:A0A0F6BIQ2"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ2"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADP73303.1"
FT                   /translation="MAGKIGNVLHYINGEFVEGASGNYFENVNPFTNEIINEVAEGWKE
FT                   DIDAAVRAAKEAFDNGPWRTMSVQERMTYILRIADLIEKYAEEISYLESLDTGLPISQT
FT                   KKQAARAAENFRFYAEMVKSRMVGEAYHVDGQFLNYTIYKPVGVAGLITPWNAPFMLET
FT                   WKVAPALATGNTVVLKPAEWSPLTANKLAEIIHEAGLPQGVFNVVHGFGETAGASLVAH
FT                   PNVRLISFTGETTTGSEIIKNSADTLKKTSMELGGKSPVIVFADADVEKALDAVVWGIF
FT                   SFNGERCTANSRLFLEKSIYDSFVEKLKERVNNISIGDPMDPATEVGPLIHRKHWETVM
FT                   NYIEIAKQEGAEVYSADVPEELKKGNFVPPTLLLNCHNSMKVAQEEIFGPVMAVMPFET
FT                   EEEVIRMANDVKYGLAAYVWTNDIKRGHRVAQSIESGMAWVNSQNVRDLRIPFGGTKYS
FT                   GIGREGGHYSFDFYTEVQVIHVSIGDHSIPKFGKIKQHSAASAQRG"
     atggcaggca aaattggcaa tgtgcttcac tatatcaatg gagaatttgt tgaaggcgct        60
     tcaggcaact attttgaaaa tgtaaacccg tttacgaacg aaatcattaa tgaagtggcc       120
     gaaggatgga aagaggatat tgacgccgct gtccgtgcgg cgaaagaagc atttgacaat       180
     ggcccgtggc ggacgatgtc tgtccaggaa cgaatgacgt atattttgcg gattgccgat       240
     ttaattgaga aatatgcgga ggaaatttcg tatttggaat cgcttgatac agggcttcca       300
     atcagccaaa cgaaaaagca ggcggcccgc gctgctgaaa atttccggtt ttatgcagaa       360
     atggtaaaaa gccgcatggt tggggaagcg tatcacgtag acgggcaatt tctcaattac       420
     accatttata aaccagtcgg tgtggcagga ttgattacgc cgtggaatgc gccttttatg       480
     ctagaaacat ggaaagttgc accggcgctg gctactggca atactgtcgt gttgaagcca       540
     gcggaatggt cgccgctgac ggcaaataaa ctggcagaaa ttatccatga agcggggctg       600
     ccccaagggg tatttaacgt tgtgcacggc tttggagaaa ccgcgggagc ttcccttgtc       660
     gcccatccga atgtacgcct catttccttt actggtgaaa caacaacagg atcggaaatt       720
     atcaaaaaca gtgctgatac gttaaaaaag acgtcgatgg aattaggcgg aaaatctccg       780
     gttatcgtct ttgcggacgc ggacgtagaa aaagcgcttg atgcggtagt atggggcatt       840
     ttctccttca atggcgaaag atgtaccgct aattcccgtt tgtttttaga aaaatcgatt       900
     tacgattcgt ttgtcgaaaa gctaaaggaa cgagtgaaca acatttccat cggagatcca       960
     atggacccgg cgacggaagt agggccgctt attcaccgaa aacattggga aacggtaatg      1020
     aactatattg aaatcgcgaa acaagaagga gcagaagtct attcggcaga cgttccagag      1080
     gaactgaaaa aaggaaactt tgtgccgcct acgctgttat tgaattgtca taacagcatg      1140
     aaagtagcgc aggaagaaat ctttggccca gttatggcgg ttatgccgtt tgaaacagaa      1200
     gaagaagtga tccggatggc taatgacgtt aaatacggat tagcagcata tgtatggacg      1260
     aatgatataa aacggggcca ccgtgtcgcc caatcgatcg aaagcggaat ggcgtgggtc      1320
     aactcgcaaa atgtcaggga tttgcgcatt ccatttggag gcacgaaata cagtggcatc      1380
     ggccgagaag gcgggcatta cagcttcgat ttttatacgg aagtgcaagt gattcatgtt      1440
     tctatcggag atcactctat accaaaattc gggaaaataa agcagcattc tgctgcctct      1500
     gcccagcgcg gataa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page