(data stored in SCRATCH zone)

EMBL: CP002293.PE448

CP002293.PE448       Location/Qualifiers
FT   CDS_pept        509225..509869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: transcriptional regulator, GntR family; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH; GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73304"
FT                   /db_xref="GOA:A0A0F6BIQ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP73304.1"
FT                   /translation="MEPKTKNKTQIAYEYILSRIESGVYGPGYRIIIDQIARELSLSSI
FT                   PVREAIRQLEAEGWIQYKPYTGAIVSNINEKEYLETLSVLAVLEGYATALSSSNMKEGM
FT                   IQQLAELNKKMEQALHEFDFEQFSELNYEFHALIYKHCGNAYLEEQIKQIWQRMKRIRA
FT                   YGFTFVPQRARESIKEHEEIIRLLKEQAPRNEIEDFVRQHKLNTAEAFKNR"
     atggaaccaa aaacaaaaaa caaaacacaa attgcctatg aatatattct ttctcgtatc        60
     gaaagcggcg tgtatggccc gggatatcgg atcatcatcg atcaaattgc ccgggagctg       120
     agtttgagca gcattccagt cagagaggca atccgtcaat tggaagcgga agggtggatt       180
     caatataagc cttatactgg tgcgatcgtc agcaacatta acgagaaaga atatttagaa       240
     acgttgtctg tcttggcagt gcttgaagga tacgcgacag cgcttagctc cagcaatatg       300
     aaggagggga tgattcaaca attagcagaa ttaaataaaa agatggagca ggcgctgcac       360
     gaatttgact ttgagcaatt tagcgaactc aattatgaat ttcatgcgct tatttacaaa       420
     cattgtggca atgcatattt agaagagcaa attaagcaaa tttggcagcg gatgaagcga       480
     atccgcgcgt atgggtttac atttgtgccg cagcgggcca gggaatccat taaagaacat       540
     gaagaaatta tccgtctgtt aaaagaacaa gcgccgcgaa acgaaattga ggactttgtc       600
     cgtcagcaca aattaaatac ggcggaagcg ttcaagaatc gctaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page