(data stored in ACNUC7421 zone)

EMBL: CP002293.PE45

CP002293.PE45        Location/Qualifiers
FT   CDS_pept        55466..55756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0045"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: SpoVG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72901"
FT                   /db_xref="GOA:A0A0F6BHK0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK0"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADP72901.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
     atggaagtta ctgacgtaag attacgccgc gtgaataccg aaggacgtat gaaagcgatt        60
     gcctctatca cattggataa cgaattcgtt gtccatgata tccgcgtgat cgatggcaat       120
     aacggattgt ttgtcgccat gccgagcaaa cgcactccag atggagaatt tcgtgatatt       180
     gcccatccga ttaactcggc gacgcgcgga aaaattcaag aggcgatatt ggctgagtat       240
     caccgtttag gtaagttgga agaagaactt gaagaagctg gtgcttcata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page