(data stored in ACNUC7421 zone)

EMBL: CP002293.PE451

CP002293.PE451       Location/Qualifiers
FT   CDS_pept        512236..513300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0474"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gka:GK3024
FT                   branched amino acid ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73307"
FT                   /db_xref="GOA:A0A0F6BIQ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73307.1"
FT                   /translation="MGLDVKKIYNGSTKGSLLVAVVLLVLPLVFSTNNYLLSTMIMIGF
FT                   YTIVSTGLTLLMGYAGQISLGQAAFYGIGSYTSAYFTTHFGLSPWLAMIAGAVLAAMVA
FT                   FVIGIPAFRLREHYLALATLGFGVIVFTFFKEWKEITGGLNGFFGIPPIRLFGITIQTD
FT                   FQFYYLVWVFALAGILFARNIVRSRVGRALLSIHGSEVAANSLGVNITKYKLQMFMISA
FT                   VYAAIAGSLYAHYVTFINPQLFEMITSIYFLIMVVIGGNGSIWGGLIGATVYVCLGELL
FT                   KEIVPLFIPNASGEFEIVFFGILLVMMLIYMPNGLSHSISKIVKRLLPDWRRKNESMLV
FT                   SENENAGSVGGERL"
     atggggttgg atgtaaagaa aatatataat ggaagcacaa aaggatcact tctggttgct        60
     gtcgttttgc ttgtcctgcc acttgttttt tcaacgaata actatttgtt aagcacaatg       120
     attatgattg gattttatac aattgtgagc acaggattga cattgctgat gggatacgca       180
     gggcaaatat cgctggggca agcagcattt tatggaatcg gatcttatac gtctgcttat       240
     ttcactactc actttgggct ttctccgtgg cttgccatga ttgccggcgc ggtcctcgca       300
     gcaatggtgg cgtttgtcat cggcatccct gcattccggt taagggaaca ttacttagca       360
     ttggctactt taggttttgg cgttattgta ttcacttttt ttaaggaatg gaaagaaatt       420
     actggcggat taaacggatt ttttggaatt ccccctatcc gcctgtttgg aattaccatt       480
     caaacggatt ttcagtttta ttatcttgta tgggttttcg cattggccgg cattcttttt       540
     gcacgtaata ttgttcgatc aagagtaggc agagcgctgt tatcaatcca tggaagcgaa       600
     gttgcagcta attcgttagg agtgaacata acaaaataca agctgcaaat gtttatgatc       660
     agcgccgttt atgcggccat tgcgggcagt ttatatgcgc attacgttac atttattaac       720
     ccgcaattat ttgaaatgat aacatctatt tattttttaa ttatggttgt aatcggtgga       780
     aatggaagta tatggggtgg tttgattggc gcgacagtat atgtatgttt aggagaactg       840
     ttaaaagaga tcgtcccgtt atttattccg aatgccagtg gggaatttga gattgtattt       900
     ttcggaattt tgcttgttat gatgcttatt tacatgccaa acggattgtc tcattccata       960
     tcgaaaatag tgaaacggtt gttacctgac tggcgacgaa agaacgagtc aatgcttgtt      1020
     tcggaaaatg agaatgccgg ctctgtaggg ggagaacgtc tatga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page