(data stored in ACNUC7421 zone)

EMBL: CP002293.PE452

CP002293.PE452       Location/Qualifiers
FT   CDS_pept        513297..514073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0475"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73308"
FT                   /db_xref="GOA:A0A0F6BIQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73308.1"
FT                   /translation="MKENVLLQVHQLSKSFGGVHAIQGVSFHVHAREIVAVIGPNGAGK
FT                   TTLFNVITGILRPTSGSIVFKGVSVVGKKPFQLAQLGMTRTFQNLQVFGNMTVIENVMV
FT                   GLHTRLKTGIFSAGFRLPRVSKEEKQALEQAFACLRQVGIEHLAFEKADILPYGMQRLV
FT                   ELARAAASNPSLILLDEPMAGLNPQESNKLVEVLLEMRSNGMTFLFVEHDMETVMSIAD
FT                   RIIVLDYGKKIAEGSPEEIAQHPDVIKAYLGEEEVI"
     atgaaggaaa atgtgctttt acaagtccat caattatcaa aatcgtttgg aggcgtccat        60
     gccatacagg gagtttcgtt tcacgttcat gctcgagaaa tagttgcggt cattggacca       120
     aacggggcag gtaagacgac gttgtttaac gtcattacag gtattctccg gccgacgagc       180
     ggctcgattg ttttcaaagg ggtttccgtc gttggcaaaa agccttttca gcttgcacag       240
     ctaggcatga cgagaacgtt tcaaaatctt caagtgtttg gaaatatgac tgtcattgag       300
     aatgtgatgg ttggtctgca cacgcggtta aaaactggga tattcagcgc cgggtttcgt       360
     ttgccgcggg tgtcaaaaga ggagaaacaa gcgttggaac aagcgtttgc atgtttgcga       420
     caagtcggga ttgaacatct tgcttttgaa aaagccgaca tattaccgta cggaatgcag       480
     cggttagtgg agctggcacg agccgctgct tccaatcctt cccttatttt attagatgag       540
     ccgatggcgg ggttaaatcc gcaagaatca aacaagttag tggaagtttt attggagatg       600
     agaagcaatg gcatgacatt tttatttgtc gagcatgata tggaaacggt aatgtccatt       660
     gcggaccgga tcattgtttt agattatgga aagaaaattg cagagggaag ccctgaagaa       720
     attgcccagc atccggatgt tattaaagca tatttagggg aagaggaggt gatatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page