(data stored in SCRATCH zone)

EMBL: CP002293.PE455

CP002293.PE455       Location/Qualifiers
FT   CDS_pept        515960..516907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0478"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73311"
FT                   /db_xref="GOA:A0A0F6BIR0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR0"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73311.1"
FT                   /translation="MKKLFILFVILAVASLFIGVQHISLADLLMLKADDVEVLIISRIP
FT                   RLISIIIAGASMSICGLIMQQLSQNKFVSPTTAGTMDCARLGILVSLILFASAGPLLKV
FT                   TIAFLFAFAGTMIFMRILEKVKYKDAIFIPLVGLMFGNIISSMTTFFAYKYNLIQSISS
FT                   WLHGDFSMIIKGRYELLYLSVPLMIVAYMYANRFTIAGMGEEIATNLGLHYRSIVNVGL
FT                   IIVAATSSVVVLTVGTLPFLGLIVPNLVTLYYGDHLEKVLPLTALSGAIFVLACDIFGR
FT                   VVIYPYEIPIGLTVGVIGSGVFLYLLVRRRKQYV"
     atgaaaaagc tgtttatatt attcgtcata ttagcagttg catctttatt tatcggtgtc        60
     cagcatattt cgcttgccga tttgctgatg ttgaaagcgg atgacgtaga agtattaata       120
     atcagccgga ttccgcggtt gatcagcatt attattgcgg gtgccagcat gagtatttgc       180
     gggctaatta tgcagcagtt aagccaaaat aagtttgtct cgccaacgac ggcggggacg       240
     atggattgcg caaggttagg aattttagtg tcattgattt tgttcgcttc cgcaggtccg       300
     ctgctgaaag ttacgatcgc atttttattc gcttttgccg gtacgatgat ttttatgaga       360
     atacttgaaa aagtgaaata taaagacgcc atttttattc cgcttgtcgg tttaatgttt       420
     ggcaatatca tcagttccat gacaacattt ttcgcgtata agtacaattt aatccaatcc       480
     atttcgtcat ggctgcatgg cgatttttcc atgattataa aagggcggta tgaactgctt       540
     tacttaagtg ttccgcttat gattgtcgct tatatgtatg cgaaccgttt tacgatagca       600
     ggaatgggag aagaaatcgc gacaaattta ggccttcatt atcggtccat cgtcaatgtt       660
     gggttaatca tcgtggctgc tacttcttct gttgtggtgc tgacggtcgg gacactgccg       720
     tttttaggat tgattgttcc aaaccttgtc acattatatt atggagatca tttagagaaa       780
     gtcctgcctc tgacggcatt gtcaggagca attttcgtgt tggcttgcga tattttcggg       840
     cgcgtcgtta tttatccgta tgaaatcccg atcggtttga cggtaggagt cattggcagc       900
     ggcgtatttt tgtatttgct agtaaggaga agaaagcaat atgtctaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page