(data stored in SCRATCH zone)

EMBL: CP002293.PE457

CP002293.PE457       Location/Qualifiers
FT   CDS_pept        517844..518602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0480"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1274 ferrichrome ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73313"
FT                   /db_xref="GOA:A0A0F6BIR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73313.1"
FT                   /translation="MVEVRGVYKQYGGKNVVDNVSITIPTGKLTSLIGPNGAGKSTLLS
FT                   IMSRLIDKDRGEVRIEGKEISQYKSDELAKKISILKQSNHIAIRLTVKELVSFGRFPYS
FT                   RGRLTREDWEYVKEAIRYMELEDLQDCYLNELSGGQRQRAYIAMVLAQDTDYIFLDEPL
FT                   NNLDMKHCVQMMKVLRKLVDELGKTIVVVMHDINFASCYSDYIVALKNGKVVREGTASE
FT                   IMSNGVLQGIYDMDVHIETIHDKKICVYFA"
     atggtagaag taagaggggt ttataagcaa tacggtggaa aaaacgtcgt tgacaacgtg        60
     tcgattacga tcccgactgg aaaattaaca tcgctcattg ggccgaacgg tgcgggaaaa       120
     agcacgctgt tatcgattat gagccgtctt atcgataaag accgcggcga agtcagaatt       180
     gaaggaaaag aaattagcca atataaaagc gatgaattgg cgaaaaagat ctccatttta       240
     aaacaatcaa accatattgc aatccggctg acggtgaaag aactcgtttc ttttggacgg       300
     ttcccgtatt cacgcggcag actgacgcgc gaagactggg agtatgtcaa agaagcgatt       360
     cggtatatgg agctggagga cttgcaagat tgttatttga acgaattgag cggcgggcaa       420
     agacagcgcg cgtatattgc catggtgctc gcgcaagata cagactacat ttttctcgat       480
     gagccgttaa acaatttaga tatgaaacat tgtgtgcaaa tgatgaaagt attgcgaaaa       540
     ttggtggatg aacttggaaa aacgatcgtc gttgtcatgc acgacattaa ttttgcgtcc       600
     tgttattctg attatattgt tgcccttaaa aacgggaaag tggttcgcga gggaacagca       660
     tcagaaatta tgagcaatgg cgtattgcaa ggcatttatg atatggacgt tcatattgaa       720
     acgatccatg ataagaaaat atgtgtttat tttgcataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page