(data stored in ACNUC7421 zone)

EMBL: CP002293.PE46

CP002293.PE46        Location/Qualifiers
FT   CDS_pept        55887..57266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0046"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: gwc:GWCH70_0045 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72902"
FT                   /db_xref="GOA:A0A0F6BHK1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK1"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADP72902.1"
FT                   /translation="MVKRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLG
FT                   IEKLITVVGFGAEQVKMQLGDQSEYAFQQEQLGTAHAVMQAASHLHGKDGVTLVVCGDT
FT                   PLITAETMQALLDHHLATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQE
FT                   RAIKEINTGTYCFDNKSLFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFE
FT                   ETIGVNDRAALAEAEKIMRARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVI
FT                   EGKTVIGEDCIIGPNSEIKDCLIGNGTTIRHSVAHDSEIGNDVTIGPFAHIRPLSKIAD
FT                   EVRIGNFVEVKKSVFGKGSKASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIED
FT                   GAFIGCNVNLIAPVTVGKGAYVAAGSTITDDVPANALSIARARQVNKENYVDRLSIKKN
FT                   S"
     atggtaaaac gatatgcggt catattggcg gccggacagg gaacaaggat gaaatcgaag        60
     caatacaaag tattgcaccc tgtttgcggt aagccgatgg tccagcatgt ggtggaccaa       120
     gttttgcagc taggaatcga aaagcttatt accgttgtag gctttggagc agagcaagta       180
     aaaatgcagc ttggcgacca aagcgaatat gctttccagc aggaacaact gggaacagcg       240
     cacgcagtta tgcaagcagc ctctcatttg cacggaaaag atggagtaac gctcgttgta       300
     tgcggagaca caccgttaat cactgcggaa acgatgcaag cattgcttga tcatcatctt       360
     gcgacaaagg caaaagcgac ggttttgacg gcaattgcgg ataatcctgc cggatatggc       420
     cgcattgttc gcgattctca tggaaatgtc gcaaaaattg tcgaacacaa agatgcaagc       480
     gaacaggaac gcgccatcaa agaaattaac acgggaacat attgctttga caacaagtct       540
     ttatttgaag cgcttacaca tgtatcgaac aataatgtgc aaggggaata ttatttaacg       600
     gatgtcattg aaattttaaa atccaatggc ggcatcattt ccgcgtacga agccccatct       660
     tttgaagaaa cgatcggggt gaatgaccgc gcggctctcg ccgaagcgga aaaaattatg       720
     cgcgcgcgga tttgccgcaa acatatgctg aacggggtca cgattattga tcctgctcat       780
     acgtatatat cggcagaggc gcaaatcggc cgcgataccg tgatttatcc cgggactgtt       840
     attgaaggga aaacagtgat tggcgaagat tgcattatcg ggccaaattc agaaattaaa       900
     gactgtctga ttggaaacgg caccacgatt cgccactctg tcgcgcacga tagcgaaatt       960
     ggcaacgatg ttacgatcgg gccgtttgcc catatccgcc cgttgtccaa aatcgcggat      1020
     gaagttcgca tcggtaattt tgttgaagtg aaaaagtcgg tgtttggcaa aggaagtaaa      1080
     gcatcacact taagctacat cggcgatgcg gaaatcggcg cggacgtcaa ccttggctgc      1140
     ggatccatta ccgtaaatta cgatgggaaa aataaacata tgacgaaaat tgaagatgga      1200
     gcgtttatcg gctgtaatgt gaatttaatt gctccggtga cggttgggaa aggcgcatat      1260
     gtcgctgctg gttcgacgat tacggatgat gttcccgcaa atgcgctgtc aattgcccgc      1320
     gctcggcaag taaataaaga gaattatgtg gatcgccttt ctattaagaa aaattcgtaa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page