(data stored in ACNUC7421 zone)

EMBL: CP002293.PE462

CP002293.PE462       Location/Qualifiers
FT   CDS_pept        522696..522908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2944"
FT                   /protein_id="ADP73318.1"
FT                   /translation="MNDISLQDTRIWGFGRPWGFGGFGGFGRPFFGGPFFGSPFFGGFL
FT                   GGLLGGALTGPFYGGFGGYPYGPVW"
     atgaatgata ttagcttgca agacacaaga atatggggat ttgggcgccc atggggtttt        60
     ggcggttttg gaggctttgg tcgcccgttc tttggcggcc cattctttgg cagcccgttt       120
     tttggcggtt ttttaggcgg attgttgggc ggcgcgctaa caggtccgtt ctatggcggt       180
     tttggtggtt atccttacgg cccagtgtgg tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page