(data stored in ACNUC7421 zone)

EMBL: CP002293.PE464

CP002293.PE464       Location/Qualifiers
FT   CDS_pept        complement(523359..524909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0487"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73320"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP73320.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
     atgtacattt attataaccg agatcaactc attttgccaa tggatcttga aattctcatt        60
     cccaaacatc atctttgccg gatcgtggat ctagccgtgg aaaaaatgga tccagctctg       120
     ctcgtttccc tctatcccgg cggaggccgc ccagcctatc atccgaaaat gatgttgaaa       180
     gtcatcctgt atgcctacgc caatcggatc tattcctctc gccaaatcgc caagcaattg       240
     aaagaaaaca tttattttat gtggctatcc ggccatcaaa caccggattt ccgcaccatc       300
     aaccgatttc ggtcggaacg gatgaaggac atcatttacg aaacgttttt ctccattgtc       360
     gatcttctgc gtcaagaagg gttggtcaaa ctagaggatt actttctgga tggaacgaaa       420
     atcgaggcca gcgccaacaa gtacacgttc gtttggcgca aatcaacgga aaagtacgat       480
     cagaagttgg aggagaaatt ccggaaaatc gtagcctcga tcgaacaggt ggtaaaagag       540
     gatgaagagt cggaacaaga aggagatttt caagaaaagc tggaagcttc accgatcacg       600
     tctgaaaaga tcgaagccgt gatcgaacaa gtggaagaac atctaaagaa agagccgaag       660
     aatcgcacgt taaagaaagc aaaacagcaa ttggaacaag acattctccc ccgtaagaaa       720
     aaatatgaag aatacaaaaa agtgttaggc gaacgaaaca gtttttcgaa aacggacccc       780
     gatgcgacgt ttatgcggat gaaagacgac catatgaaaa acggccagct caaaccggga       840
     tataatgtgc agatagggac agagaaccaa ttcatcactg gatttagcgt gcatcaacgg       900
     gcgggggatg ccggatgctt cattccacat ttggagcaat tggccgccta tgggcgtccc       960
     atgcctaaac gagcgattgc ggattccgcc tatgggagtg aggagaacta cacgtactgc      1020
     gagaaaaagc agatcgtcgc gctgatcaag tacaacacat tggaccggga acaaacgaaa      1080
     gcgtgggcga aagagatcgg ccgaatcgag aacatgacgt acgatgagga attggatgag      1140
     tggatttgcg cgaaagggga acggctggtg tttgtgtata aacggaagga aacgaccgac      1200
     aacgggtacg tcatcgtcaa acggacgtat cgttgtacag catgtgccgg atgcccgttt      1260
     caagcagcat gtgccaaagg caaagacacg aaaaccatcc gcgtttcctt gaaaaatcaa      1320
     caacaacggc aagaaatccg gaaacggctg tccacggaag aaggggcgac gacatatcga      1380
     agacggcaaa tcgaaaacga gccggtgttt gggcaaatca agcataatca gcaatttcat      1440
     cggttttcat tgagaggcct cccaaaaatt accttggagt ggggtctagt ttgtgctgcc      1500
     cacaatttga gaaagtgggc cacaacgacc gacccaacaa ggaaaaaata g               1551
//

If you have problems or comments...

PBIL Back to PBIL home page