(data stored in ACNUC7421 zone)

EMBL: CP002293.PE466

CP002293.PE466       Location/Qualifiers
FT   CDS_pept        complement(525417..525680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS1"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2940"
FT                   /protein_id="ADP73322.1"
FT                   /translation="MQQQMNTQQPSAMPQPPQIISTKDALYFTDMLSWNLLAMKKAHFF
FT                   ASQCQDKEVSAAIEKAGQMHQRHYQQILSHLQNTGRPKTPMQ"
     atgcaacaac aaatgaacac gcaacaacca tcggctatgc cgcagccgcc gcaaatcatt        60
     tcaacaaaag acgcacttta tttcactgat atgctgtcgt ggaatttgct cgcgatgaaa       120
     aaagcccact tttttgcatc gcaatgccaa gacaaagaag tcagcgccgc gatcgaaaag       180
     gccgggcaaa tgcatcagcg ccattaccaa caaattttaa gccatctgca aaatacaggc       240
     cggcctaaaa cgccaatgca atag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page