(data stored in ACNUC7421 zone)

EMBL: CP002293.PE468

CP002293.PE468       Location/Qualifiers
FT   CDS_pept        complement(527637..528578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS3"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0868"
FT                   /protein_id="ADP73324.1"
FT                   /translation="MKKLKLFISILLMLTFFILPVSTTPTSKTTNEVSIPLSNSNPKSI
FT                   SIKMPGKTFEFIKSTSFTHIKAKDKNYYYKIKDKNEILANLRVTIRTIDNGDKFIFTRI
FT                   TNYSKQNIYTDLIIPLSNTTTYNLEKYSDRDKIIRQHDHVFGIDPTSYPIGVLNTYNKN
FT                   QTVASMMLGKNYISRQLVKRYSKTRASYVREFFEETDNYKIYLNSKTKSTFINLNLKTQ
FT                   SNSIGESWVLISNQPLFKNKNNMDYWMKRSIEEYISTHKWLTADGPYFKLPWSIEPATK
FT                   MGFGRNLGYMQGDDFVSTYSFTKERFFYNYDY"
     atgaaaaaat taaagctatt tatttcaatt ttattaatgc taactttctt tattttacca        60
     gtatcaacta ccccaacctc aaaaaccact aatgaagttt ctattccatt aagtaactca       120
     aatccaaaaa gtatctcaat taaaatgcct ggaaaaactt ttgaatttat caaatctaca       180
     tcattcactc atattaaagc aaaagataaa aactactatt ataaaatcaa agacaaaaac       240
     gaaattttag ccaatttaag agtaacaata agaacaattg ataatggtga taaatttata       300
     tttactagaa ttacaaacta ttcaaaacaa aacatctata ctgacttaat aattccatta       360
     tctaatacaa ctacttataa cctcgaaaaa tacagtgata gagacaaaat tattagacaa       420
     cacgaccatg tttttggtat tgatccaact tcatatccaa ttggagtgct taacacatac       480
     aataaaaatc aaacagtagc aagcatgatg ttaggcaaaa actatatttc gagacaactt       540
     gtaaaacgat acagcaaaac tcgcgcaagc tacgtgaggg aattttttga ggaaactgat       600
     aattataaaa tttacttaaa ttcaaaaaca aaatctactt ttatcaattt aaatttaaaa       660
     actcaatcta attctattgg agaaagctgg gttttaattt ctaatcaacc tttattcaaa       720
     aacaaaaaca atatggacta ttggatgaaa cgtagcattg aagaatatat atctactcat       780
     aaatggctaa cagctgacgg tccatatttc aaattacctt ggtcaattga accagcaaca       840
     aaaatgggat ttggaagaaa cttgggttat atgcaaggtg atgattttgt aagtacttat       900
     tcttttacaa aagaaagatt tttctataat tatgattatt aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page