(data stored in ACNUC7421 zone)

EMBL: CP002293.PE471

CP002293.PE471       Location/Qualifiers
FT   CDS_pept        531712..532884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0495"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   gwc:GWCH70_2936 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73327"
FT                   /db_xref="GOA:A0A0F6BIS6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP73327.1"
FT                   /translation="MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVRETLKRAGNY
FT                   EGNIDDLIIGCAMPEAEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERI
FT                   MLGHSDTIIAGGVESMSLVPMMGHVIRPNAKLAEEAPQYYMSMGHTAEQVAMKYGVSRE
FT                   DQDAFAVRSHQRAAKAIREGKFKDEIVPVEVTVRKVENNKLVEKTILFEEDEGVRPDTN
FT                   METLAKLHPAFSVNGTVTAGNASQMSDGAAAVMVMDREKAESLGLKLLGKFRSFAVAGV
FT                   PPEVMGIGPVAAIPKALKLAGLELSDIGLIELNEAFASQAIQVIRELGLDEEKVNVNGG
FT                   AIALGHPLGCTGAKLTLSLLYEMRRRNVQFGIVTMCIGGGMGAAGVFELI"
     gtgagagaag cggtgattgt tgcgggagcg cgcacgccgg tcggaaaggc gaaaaaaggc        60
     acgctcgccc atgtgcggcc ggatgattta ggcgcgcttg ttgtgaggga aacgttgaaa       120
     cgagccggga attacgaagg aaatatcgat gatcttatta ttggctgcgc gatgccggaa       180
     gcggagcaag ggttaaatat cgcgagaaac ataggagcgc ttgcaggact tccatacacg       240
     gttccggcga taacgatcaa tcgttattgc tcgtcgggct tgcaagcgat tgcttacgca       300
     gcggagcgca tcatgcttgg ccattcggat acgatcattg ccggcggtgt ggaatcgatg       360
     agccttgtcc cgatgatggg gcatgtaata cgtccaaacg cgaaactggc agaagaagct       420
     ccacagtatt atatgtccat gggacatacg gcagagcaag tggcgatgaa gtatggggtt       480
     agccgggaag accaagacgc gtttgctgtg agaagccatc agcgcgctgc aaaagcgatc       540
     cgcgaaggca aattcaagga cgaaattgtc ccggttgaag tgaccgttcg caaagtagaa       600
     aataacaagc ttgtcgagaa aacgatactt ttcgaagagg atgaaggggt gcgcccggat       660
     acaaatatgg aaacgttagc aaaactccat ccggcatttt ccgtaaatgg aacggtaacc       720
     gctgggaacg cttcgcaaat gagcgatggc gctgccgctg tcatggtgat ggaccgggaa       780
     aaagcagaat cgctagggct aaaattgctt gggaaattcc gttcattcgc cgtcgccggc       840
     gtgccgccgg aagtaatggg aatcggcccg gtcgccgcaa tcccgaaagc gttaaaactt       900
     gccggcttag aactttctga tatcggattg attgaactaa atgaagcttt tgcgtcccag       960
     gcgattcaag tgattcgcga gcttgggctt gatgaggaaa aagtcaatgt caacggagga      1020
     gcaatcgcac ttggccaccc acttggctgt actggcgcaa aattgacgtt gtcattgctc      1080
     tatgaaatgc gccgccgcaa cgtgcagttt gggattgtca cgatgtgcat cggcggcggc      1140
     atgggcgcag caggggtatt tgaattaatt taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page