(data stored in ACNUC7421 zone)

EMBL: CP002293.PE472

CP002293.PE472       Location/Qualifiers
FT   CDS_pept        532954..534738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0496"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: gwc:GWCH70_2935 acyl-CoA dehydrogenase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73328"
FT                   /db_xref="GOA:A0A0F6BIS7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS7"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADP73328.1"
FT                   /translation="MAKALENAIKGGSFLIEDIPCERVFTPEDFTDEHKMIAKTTEDYV
FT                   VNEVLPQLEHLENHEFDRSVQLLRKAGELGLLSADIPEEYGGLGLDKISSALIGEKMSR
FT                   AGGFSISHGAHVGIGSLPIVLFGTEEQKRKYLPSLATGEKIAAYALTEPGSGSDALGAK
FT                   TTARLNAEGTHYILNGEKQWITNAGFADVFIVYAKVDGEHFSAFIVERGFPGVSTGPEE
FT                   KKMGIKSSSTRTLILQDVPVPKENLLGEVGKGHVIAFNILNIGRYKLGVGAVGGAKRAL
FT                   EITLQYANQRQQFKQPISKFSLTQEKFATMASRLYATESSVYRTVGLFDERMGLLDEEK
FT                   AKDGKEIAKSIAEYAIECSLNKFFATETLDYIVDEGVQIHGGYGFMQEYEIERAYRDSR
FT                   INRIFEGTNEINRLLVPGMYLKKAMKGELPLLQKAQQLQEELIMLAPEEVGDGVLEQEK
FT                   YLVRNAKKIALMAAGLAAQRFGPKLENEQEILVNIADIVANIYAMESAVLRTEKAINRS
FT                   GVEKNKQKLLYTQIFCQEAFNEIEAHAKETIVAVEQGDTLRMMLTALRKLTRYTPINII
FT                   AKKREAAAALIEAERYIV"
     atggcgaaag cattagaaaa tgcgataaaa ggcggaagct ttctgattga agacattcct        60
     tgcgaacgtg tgtttacacc ggaggatttt acagatgagc ataaaatgat tgcgaaaaca       120
     acagaagatt atgtcgttaa cgaagtgctt ccgcaattag aacatttgga aaaccatgaa       180
     tttgaccgtt cggttcagct gctaagaaaa gcaggagagc ttggattgct tagtgcggat       240
     attccggaag aatacggcgg cttagggctt gataaaatca gctctgcact gatcggggag       300
     aaaatgtcgc gcgctggggg cttctcgatt tctcatggcg cgcacgtcgg cattggctcg       360
     cttccaatcg tcttgttcgg aacagaagaa caaaaacgaa aatatttgcc atcgttagcg       420
     actggtgaaa aaattgccgc atatgcatta acagagcctg gctccggttc agatgcgcta       480
     ggcgcaaaaa cgacggcgag attaaacgcg gagggaaccc attacatttt aaacggcgaa       540
     aaacaatgga taacaaacgc cggatttgcc gatgtgttta tcgtatacgc gaaagtagac       600
     ggcgagcatt tctccgcatt cattgtcgaa cgaggctttc cgggggtctc taccgggccg       660
     gaagaaaaga aaatggggat taaaagttct tcgacccgta cattaatttt gcaagacgtg       720
     cctgttccga aagaaaactt gcttggggaa gttggaaaag gccatgtgat tgcgttcaac       780
     atcttaaaca tcggccgcta taaactggga gtcggcgctg ttggcggcgc gaaacgcgcg       840
     ctggaaatta cgctgcaata cgcgaatcag cgccagcaat ttaaacagcc gatttcaaag       900
     ttttcattaa cacaagaaaa attcgcgacg atggcttccc gcttatatgc cacagaaagc       960
     tctgtctacc gcactgtcgg cttgtttgac gaacggatgg gccttcttga tgaggaaaaa      1020
     gcaaaagatg gaaaagaaat cgcgaaatcg atcgcagaat atgccattga atgctcgctg      1080
     aacaaatttt tcgcgacgga aacgttggac tatattgtcg atgaaggcgt gcaaattcac      1140
     ggcggttacg gatttatgca agaatatgaa attgagcggg cttaccgcga ttcccggatt      1200
     aaccggattt ttgaaggaac aaacgaaatc aaccgcctgt tagttccggg aatgtatttg      1260
     aaaaaagcga tgaaaggcga gcttccgctt ttgcaaaaag cacaacagct tcaggaagaa      1320
     ttaatcatgc tcgcgccaga agaagttggt gacggcgttc tggagcaaga aaaatattta      1380
     gtacgcaatg caaaaaaaat cgccttaatg gcggcgggat tagcagcgca aagattcggc      1440
     ccgaaactgg aaaatgaaca ggaaatttta gtaaacattg ccgacattgt ggcgaatatt      1500
     tacgcgatgg aatctgccgt gcttcgcacc gaaaaggcaa tcaacagatc cggggtagaa      1560
     aaaaacaaac aaaaacttct ttatacgcaa attttctgcc aagaagcgtt caacgaaatc      1620
     gaagcacatg caaaagagac gattgtggcg gttgagcagg gcgacacatt gcgcatgatg      1680
     ctgactgctt tgcgtaaatt aacgcgctat accccaatca atatcatcgc gaaaaaacgg      1740
     gaagcagcag cggcgctcat tgaagcggaa cgttatattg tgtaa                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page