(data stored in ACNUC7421 zone)

EMBL: CP002293.PE473

CP002293.PE473       Location/Qualifiers
FT   CDS_pept        534793..535155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0497"
FT                   /product="arsenate reductase-like protein"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   gwc:GWCH70_2934 arsenate reductase and related"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73329"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS8"
FT                   /inference="protein motif:PFAM:PF03960"
FT                   /protein_id="ADP73329.1"
FT                   /translation="MSFTFYWYPKCGTCRKAKKWLDEHHIAVREIHIVDNPPAKEELTE
FT                   LYRKSGLPLKKFFNTSGMKYRQLGLKDKVNTASEEELLELLASDGMLVKRPILTDGNHV
FT                   IVGFNEEQYEKFFGQK"
     atgtcattca ctttttattg gtatccaaaa tgcggcacat gccggaaagc aaaaaaatgg        60
     ctcgatgaac atcacatcgc tgtccgggag atacatattg tcgacaaccc gccggcaaaa       120
     gaggaattga cggaacttta ccgcaaaagc ggactgccgc tgaaaaaatt ctttaacaca       180
     agtggcatga aatatcgtca gttagggtta aaagataaag tgaataccgc ttcggaagaa       240
     gaacttctgg aattgctcgc ttccgatggc atgttggtca agcgtccgat tttgacagat       300
     ggaaatcatg ttatcgttgg gtttaatgaa gaacaatatg aaaaattttt tggacaaaaa       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page