(data stored in ACNUC7421 zone)

EMBL: CP002293.PE475

CP002293.PE475       Location/Qualifiers
FT   CDS_pept        536125..536475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0499"
FT                   /product="TOPRIM domain-containing protein"
FT                   /note="KEGG: gwc:GWCH70_2931 toprim domain protein; PFAM:
FT                   TOPRIM domain-containing protein; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73331"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT0"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADP73331.1"
FT                   /translation="MIEIEKVIIVEGRSDKQKIEKIINEPVEVICTNGTISDAKLEELI
FT                   EELYYKDVYILVDADEAGEKLRKQFRREFPEAEHIYIDRTYREVAAAPNWHIAQVLLRA
FT                   NFNVHYDYLLKR"
     atgatagaaa ttgaaaaagt gattattgtg gaagggcgtt ccgacaaaca aaaaattgaa        60
     aagattatta atgaaccggt tgaagtgatt tgcacaaacg gaacgattag tgatgcgaaa       120
     ttggaagaac tgattgaaga actttattat aaagatgttt atatattagt ggatgccgat       180
     gaagcggggg aaaaattgcg gaaacagttt cgccgcgaat ttcctgaagc agaacatata       240
     tatattgacc gaacgtaccg ggaagtcgct gcggcgccaa attggcatat cgcccaagta       300
     ttattgcggg caaattttaa tgtccattat gattatttgt taaaaaggtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page