(data stored in ACNUC7421 zone)

EMBL: CP002293.PE476

CP002293.PE476       Location/Qualifiers
FT   CDS_pept        536484..536804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0500"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /note="PFAM: Thioredoxin domain-containing protein; KEGG:
FT                   gwc:GWCH70_2930 thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73332"
FT                   /db_xref="GOA:A0A0F6BIT1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT1"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADP73332.1"
FT                   /translation="MKKLQLAEIDDILDKEETVCLFVYTPLCGTCQLAERMLEVVKELF
FT                   PGIPFYKTDINYMPERAVTWKIESVPCLLLFDGGNIVQKLYAFHSVTYLYETIKKIWAE
FT                   NR"
     atgaaaaaac tacagttggc tgaaatagac gacatccttg ataaggaaga aactgtttgc        60
     cttttcgtgt atacgccgct gtgcggcact tgccagcttg ccgagcggat gctggaagtg       120
     gtcaaagagc tgtttccggg cattccgttt tacaaaaccg atattaatta tatgcctgaa       180
     cgtgcggtta catggaaaat tgaaagtgtc ccatgcctgc ttttatttga tggcggcaat       240
     atcgtccaaa aattgtacgc atttcattct gtaacgtatt tatatgaaac aatcaagaaa       300
     atttgggcgg aaaacaggta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page