(data stored in SCRATCH zone)

EMBL: CP002293.PE477

CP002293.PE477       Location/Qualifiers
FT   CDS_pept        537025..537366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0501"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   gwc:GWCH70_2929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73333"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT2"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADP73333.1"
FT                   /translation="MHELIKQLTERMQKLNHLSPILPDEELYIQFECETETAVVAVSKH
FT                   SIEQKEAADERQVLTVRGSKEALEALLNGRLKLQQQIRLHEVNISGSFRHMLLLESLLH
FT                   LSKPYRHVC"
     atgcatgaat tgataaaaca gcttacagaa cgaatgcaaa agttgaatca tttatcaccg        60
     attttgccag atgaagaatt atacattcaa tttgaatgcg aaacagaaac agcagttgtg       120
     gcggtttcta aacacagcat cgagcagaag gaagcggcag acgaacggca ggtattgacg       180
     gtccgtggat cgaaagaggc gctcgaagcg ctgttaaatg gaaggctcaa attgcaacaa       240
     caaatccggc ttcacgaagt gaatatttct ggaagtttcc gccatatgtt gctgctcgag       300
     tcgctgcttc atttgtcaaa gccgtatcgc catgtctgct aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page