(data stored in SCRATCH zone)

EMBL: CP002293.PE479

CP002293.PE479       Location/Qualifiers
FT   CDS_pept        539054..539722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0503"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_2925
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73335"
FT                   /db_xref="GOA:A0A0F6BIT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73335.1"
FT                   /translation="MLANLLPNVEWDMMWAATVETLYMTGIAVAVTFILGTILGLLLFL
FT                   TSKGNLWENRLANMIIAAAVNIFRSIPFIILIILLIPLTKWLVGTMLGANAALPALIIG
FT                   AAPFYARMVEIALREIDKGVIEAAKAMGASTATIIWKVLLPESLPALVSGITVTAIALV
FT                   GYTAMAGVVGAGGLGNLAYLEGFQRSHNDVTFVATVLVLIIVFVIQFIGDFVTSKIDKR
FT                   "
     atgctcgcta acctcttacc gaacgtagag tgggatatga tgtgggcagc tactgttgag        60
     acgctttata tgacaggaat tgcagttgcg gtgacattta tattaggaac gattcttgga       120
     ctgctgttat ttttaacgtc gaaaggcaat ttatgggaga atcgcttagc gaatatgatc       180
     attgctgctg ctgtcaatat ttttcgttct attccattta ttatattgat tattttatta       240
     attccgctga cgaaatggct ggttggaaca atgcttggtg ccaatgccgc gctgccggcg       300
     ctcattatcg gagcggcgcc attttacgcg cgaatggtcg aaattgcact ccgcgaaatt       360
     gataaaggcg ttattgaagc ggcgaaagcg atgggagctt caacggcaac aattatttgg       420
     aaagtgttgc tgccagagtc cttgcctgca cttgtgtctg gaatcaccgt aacagcaatt       480
     gctttagtcg gatatacggc gatggcgggg gttgtcggcg ctggaggcct tggcaactta       540
     gcatatttgg aaggattcca gcgcagccat aacgatgtga cgtttgtcgc caccgtgctc       600
     gtgctaatca ttgtttttgt cattcagttt atcggtgact ttgtcacttc caaaatagat       660
     aaacgataa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page