(data stored in SCRATCH zone)

EMBL: CP002293.PE480

CP002293.PE480       Location/Qualifiers
FT   CDS_pept        539739..540578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0504"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: gwc:GWCH70_2924 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73336"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT5"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADP73336.1"
FT                   /translation="MKKWLSALFAVVLVLALAACGGNNNASDGQEKGKLTKLVVGASNV
FT                   PHAEILEKAKPILKEKGIDLEIVKFQDYILPNKALADKEIDANYFQHIPYLESQKKEHG
FT                   YDFVNAGGIHIEPIGIYSKKYKSLDELPDGATIIMSNSVADHGRILSMLQEKGLIKLKD
FT                   GVDKTKATVKDIVENPKHLKFEADVDAGMLPQIYKNGEGDAVLINANYALDAGLDPAKD
FT                   PIAVESPKDNPYVNIIAVRKGDENRKEIKTLVEVLQSKEIQDFIKKEYKGAVIPAAQ"
     atgaaaaaat ggcttagtgc attatttgct gttgtccttg tgctggcatt ggcagcgtgc        60
     ggaggaaaca acaacgcgtc tgatggccaa gaaaaaggaa aattgacgaa attagtagtc       120
     ggagcttcga atgttccgca tgcggaaatt ttggaaaaag caaaaccgat tttaaaagaa       180
     aaagggattg acttagaaat cgtgaagttc caagattata ttttaccaaa caaagcgctg       240
     gcggataaag aaatcgacgc gaactatttc caacacattc catatttaga atcacagaaa       300
     aaagagcatg gatatgactt tgtcaacgct ggcggcattc atattgagcc aatcggcatt       360
     tattcaaaaa aatataaaag cttagatgaa cttccagacg gcgcaacgat catcatgagc       420
     aactcggttg cagaccatgg ccgcatttta tccatgctgc aagaaaaagg attgattaag       480
     ttaaaagatg gcgtggacaa aacaaaagca acggtgaaag acattgtcga gaatccgaaa       540
     catttaaaat ttgaagcaga tgttgatgcg ggaatgctgc cgcaaattta taaaaacggt       600
     gaaggcgatg cggtcttgat taacgcgaac tatgcgttag acgccggttt ggaccctgca       660
     aaagacccga tcgctgtcga gtcgccaaaa gataatccgt atgtcaacat tatcgctgtc       720
     cggaaaggcg acgaaaaccg caaagaaatt aaaacacttg tcgaagtatt gcagtcaaaa       780
     gaaattcaag actttattaa aaaagaatat aaaggtgccg tcattccagc ggcccaataa       840
//

If you have problems or comments...

PBIL Back to PBIL home page