(data stored in ACNUC7421 zone)

EMBL: CP002293.PE482

CP002293.PE482       Location/Qualifiers
FT   CDS_pept        541372..542151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0506"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: gwc:GWCH70_2923 FeS assembly
FT                   ATPase SufC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73338"
FT                   /db_xref="GOA:A0A0F6BIT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT7"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ADP73338.1"
FT                   /translation="MAVLTIKDLHVSVEGKEILKGVNLEVKGGEIHAIMGPNGTGKSTL
FT                   SSAIMGHPKYEVTQGSITLDGQNVLEMEVDERARAGLFLAMQYPSEISGVTNADFLRAA
FT                   INARLGEGNEISLMKFIRKLDEKMEFLEMNPDMAHRYLNEGFSGGEKKRNEILQLMMLE
FT                   PKIAILDEIDSGLDIDALKIVSKGINEMRSSEFGCLIITHYQRLLNYITPDYVHVMMQG
FT                   RIVKSGGPELAQRLEAEGYDWIKKELGIEDETVEQEA"
     atggcagtgt tgacaattaa agatcttcac gtatccgttg aaggaaaaga aattttaaaa        60
     ggcgtgaatt tggaagtaaa aggcggagaa attcacgcca tcatgggacc gaacggaacg       120
     gggaaatcaa cgctatcatc ggcgattatg gggcatccga aatatgaagt gacacaaggc       180
     agcattacgt tagatggaca aaatgtactg gagatggaag tggatgagcg cgcacgcgcc       240
     ggtttatttt tggcgatgca atatccaagt gaaataagcg gggtaacgaa tgcggatttc       300
     cttcgtgctg ctattaatgc ccgccttggc gaaggtaacg aaatttcgtt aatgaaattt       360
     atccgcaaac tggatgaaaa aatggaattt cttgaaatga atccggatat ggcgcatcgt       420
     tatttaaatg aaggattctc cggcggggag aaaaaacgca atgaaatcct tcaattaatg       480
     atgcttgaac cgaaaatcgc cattttggac gagatcgact ctggtctgga tatcgatgcg       540
     ctgaaaatcg tttcaaaagg aattaatgaa atgcgcagca gcgaattcgg ctgtttgatc       600
     attacgcact atcagcggct gttaaactac atcacaccag attatgtgca tgtcatgatg       660
     caagggcgca tcgtaaaatc cggtggcccg gaactggcgc aacgtcttga agcagaagga       720
     tacgattgga taaaaaaaga acttggcatt gaagacgaaa cggttgagca agaagcgtaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page