(data stored in ACNUC7421 zone)

EMBL: CP002293.PE487

CP002293.PE487       Location/Qualifiers
FT   CDS_pept        547039..547887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0511"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   gwc:GWCH70_2914 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73343"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU2"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADP73343.1"
FT                   /translation="MIYIGLTGWGDHDSLYPPGLAAKDKLQEYAAHFPTVEVDSYFYAI
FT                   QPRQNVEKWIRETPDSFRFVVKAYQGMTGHERGPIPYSSKEEMFAAFLDSIEPFIRSGK
FT                   LAMVLFQFPPWFDCRREHVTYLRWCKAQMKEVPVALEFRHRSWFSPRFYAKTLQFMTEE
FT                   GWIHSICDEPQAGEGSIPTVLHPTNAEKTLVRLHGRNVYGWNKATSGENWRAVRYLYRY
FT                   REDELREWVAHIETLKTKTNDIYVLFNNNSGGDAADNAKQFIRLLGIEYTDLAPRQLDL
FT                   F"
     atgatttata tagggttaac cggttggggt gatcacgaca gcttatatcc tccaggtctt        60
     gccgcgaaag ataagctgca agaatatgcc gctcattttc ccactgtaga agtagattcg       120
     tatttttatg cgattcagcc gcggcagaat gtcgaaaagt ggattcgcga aacgcctgac       180
     tcgtttcgct ttgtcgtgaa agcataccaa ggaatgacgg ggcatgagcg cggcccgatt       240
     ccatattcaa gcaaagagga aatgtttgcc gcctttttag attccatcga accgtttatc       300
     cgttcgggaa aactggcgat ggtgctgttt cagtttccgc catggtttga ttgccgccgc       360
     gagcatgtca catatttgcg ctggtgcaag gcgcaaatga aagaagttcc ggtggcgctt       420
     gagttccgcc atcgttcatg gttttccccg cgtttttatg caaaaacgtt acagtttatg       480
     acggaagaag gatggattca tagcatttgc gatgagccgc aggcagggga aggctccatt       540
     ccaaccgtgc ttcatccgac taatgcggaa aaaacgttgg ttcgcttgca tggacgcaac       600
     gtatatggat ggaataaggc gacaagcggg gaaaattggc gggctgtaag atatttatac       660
     cgataccgcg aagatgaatt gcgcgaatgg gtggcgcata ttgaaacatt aaaaacgaag       720
     acaaatgata tttatgtgtt gtttaacaac aattccggcg gggatgctgc ggataacgcg       780
     aagcaattca tccgcctgct cggcattgag tatacggatt tagcgccacg gcagctggat       840
     ttattttag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page