(data stored in SCRATCH zone)

EMBL: CP002293.PE489

CP002293.PE489       Location/Qualifiers
FT   CDS_pept        548743..550134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0513"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase
FT                   domain-containing protein; KEGG: gwc:GWCH70_2912
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73345"
FT                   /db_xref="GOA:A0A0F6BIU4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADP73345.1"
FT                   /translation="MKRTIYVYHTNDVHSHFEYWPKISHFLWEQRQKHEKRNETMLLFD
FT                   IGDFIDRFHPITEATRGKANVDLLNELHYDAVTIGNNEGITLDYNELDTLYENARFPVL
FT                   VANLFKKDGTRPSWAHPYCIIPVSDTFRVGVIGATAYFTKSYELLGWKVATPFEILGDI
FT                   AAEVKKQADLVILLSHLGINDDEKIAQTIPEIDIILGGHTHHLFPEGKRVHDTLLCAAG
FT                   KYGKFVGIVKLEIEESDHTYEALATVVDVEGFPDSEKMRRTLALLEKQSLQKLESEQVA
FT                   ELKEDLPLQWFSPSPLAKLLASALREWCEAEIGMVNAGVLLEPLYKGTVTRKDLHRICP
FT                   HPINPCKVQLRGAELKEIILQANTERMKYLEFKGFGFRGKVMGQMVYDGVELEMETGKD
FT                   GYEHIRRITINGEPLNPDQLYDVATIDMFAIGHFYPQIQRAPKKEYYMPEFLRDVLAWK
FT                   LADRK"
     ttgaaacgga caatatacgt ataccatacg aacgatgtgc acagccattt tgaatattgg        60
     ccgaaaattt cccatttttt atgggaacaa agacaaaagc atgaaaaacg taatgagaca       120
     atgctgttat ttgatattgg cgattttatt gaccgctttc atccgataac ggaagcgaca       180
     agaggaaagg cgaatgtgga tttgctgaat gagctccatt acgatgcggt aacgatcgga       240
     aataatgaag gaataaccct tgattacaat gaactggaca cactgtatga aaacgcgcgc       300
     tttccggtgc ttgtcgccaa tttatttaag aaagatggga cgcgtccttc ttgggcgcat       360
     ccgtactgca ttattcccgt ttccgacacg ttccgcgtcg gcgtgattgg cgccaccgct       420
     tatttcacta aatcttacga actattgggt tggaaagtgg caacaccgtt tgagatactg       480
     ggagacattg ccgcggaggt aaaaaaacag gctgatcttg tcattttatt atctcattta       540
     gggattaacg atgatgagaa aatcgcacag acgataccgg aaattgacat cattcttggc       600
     gggcataccc atcatttatt cccagaagga aaaagggtcc atgacacgtt attatgcgcg       660
     gcaggaaaat atggaaaatt tgttgggatc gtaaagttag aaattgaaga aagcgaccat       720
     acatatgaag cgctggctac cgttgtggat gtggaaggct ttccagattc agagaaaatg       780
     cggcgcactt tagcgttatt agaaaaacaa agtttgcaaa aattagaatc agagcaagtg       840
     gcagagctga aagaagatct gccgctgcaa tggttttcgc catctccgct cgccaaactg       900
     cttgcttcgg cgcttagaga atggtgtgaa gcagaaattg gcatggtcaa tgcgggcgtc       960
     ctgttagagc cgctttacaa agggacggtg acgagaaaag atttgcaccg catttgcccg      1020
     catccgatca atccttgcaa agtccagctg cgcggcgcgg aattaaagga gattatttta      1080
     caagcaaata cagaaagaat gaaatacttg gaatttaaag gatttgggtt tcgcggcaaa      1140
     gtgatgggac aaatggtgta tgacggggtt gaactggaaa tggaaacggg aaaagacggt      1200
     tatgagcata ttcgccgtat aaccattaac ggcgagccgt taaatccgga ccagctatac      1260
     gatgtggcga caattgatat gtttgcgatc gggcattttt atccgcaaat ccagcgcgct      1320
     ccgaaaaaag aatattatat gccggaattt ttgcgggatg ttttagcgtg gaaattagcg      1380
     gacagaaaat ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page