(data stored in ACNUC7421 zone)

EMBL: CP002293.PE49

CP002293.PE49        Location/Qualifiers
FT   CDS_pept        59003..59566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0049"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   gwc:GWCH70_0048 peptidyl-tRNA hydrolase; PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72905"
FT                   /db_xref="GOA:A0A0F6BHK4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK4"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADP72905.1"
FT                   /translation="MLKLFVGLGNPGKEYEQTRHNVGFMVIDELAKRWNISFQTAKFNG
FT                   MIASHIISGEKVILCKPLTYMNLSGECVRPLIDYYRIDINDVVVIYDDLDLPVGKIRLR
FT                   MKGSAGGHNGIKSLIHHLGTQEFKRIRIGIGRPASGEKVIDYVLGRFHEEESGAIMEAI
FT                   LRSADACEKAVTEPFLQVMNEFNV"
     gtgttgaagt tatttgtcgg ccttggcaac ccagggaaag aatatgaaca aacgaggcat        60
     aacgttgggt ttatggtcat cgatgagctg gcgaaacgct ggaatatttc ttttcaaaca       120
     gcaaaattta atgggatgat tgcctcgcac atcatttctg gcgaaaaagt gatattatgc       180
     aagccattaa catatatgaa tttatcaggg gaatgcgtcc gaccgttaat cgattattat       240
     cgcattgata tcaatgatgt tgttgttata tatgatgacc ttgatctccc tgtcggaaaa       300
     attcgcctgc gcatgaaagg aagcgccggc gggcataatg gcattaagtc gcttattcac       360
     catttaggaa cgcaagaatt caaacggatt cggatcggca tcgggcgccc ggcaagcggg       420
     gaaaaggtga tcgattatgt gctgggccgc ttccacgaag aagaaagcgg ggcgatcatg       480
     gaagcgattt tacgttcagc cgatgcgtgt gaaaaagctg ttactgagcc gtttttgcaa       540
     gtgatgaatg aatttaatgt gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page