(data stored in SCRATCH zone)

EMBL: CP002293.PE490

CP002293.PE490       Location/Qualifiers
FT   CDS_pept        550188..550505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0514"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="PFAM: Domain of unknown function DUF1805; KEGG:
FT                   gwc:GWCH70_2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73346"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU5"
FT                   /inference="protein motif:PFAM:PF08827"
FT                   /protein_id="ADP73346.1"
FT                   /translation="MMISVTPITIDHYPFIAVSVQLPKTNLLAVASEKGYIMCGALDVA
FT                   LLNEKLRDRGIVAGRAVGVRTIEQLLEAPLESVTAAAEELGITVGMKGKEALLKMREKN
FT                   L"
     atgatgatta gcgtaactcc aattacgatt gatcattatc cgtttatcgc cgtttccgtt        60
     cagttgccga aaacgaattt gcttgctgtg gcaagcgaaa aaggctacat tatgtgcggc       120
     gcgttagatg tcgcgctgtt gaatgaaaaa ttgcgcgatc gcggaattgt tgccggaagg       180
     gccgttggcg tccgcaccat cgagcaatta ttagaagcgc ctttggaatc ggtgacggct       240
     gccgctgaag aattagggat tacggttggc atgaaaggga aagaggcgct cttaaagatg       300
     agggaaaaaa atttataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page