(data stored in SCRATCH zone)

EMBL: CP002293.PE491

CP002293.PE491       Location/Qualifiers
FT   CDS_pept        550564..551310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0515"
FT                   /product="sporulation protein YunB"
FT                   /note="KEGG: gwc:GWCH70_2910 sporulation protein YunB;
FT                   TIGRFAM: sporulation protein YunB; PFAM: Sporulation
FT                   protein YunB-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73347"
FT                   /db_xref="GOA:A0A0F6BIU6"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU6"
FT                   /inference="protein motif:TFAM:TIGR02832"
FT                   /protein_id="ADP73347.1"
FT                   /translation="MPRFPARLRKGPLPLRYVFLLTFVFFMFATAVSLWIVNKAIEPVL
FT                   MEIAEKETKRIANLVINNAIEQQFLKENTEMSDLITVQKDESGKIASVDFNTAVVNRIL
FT                   AKTDDYVMQSLKAATEGKIAELEFPDDKSEKEKNNGIIYYIPIGQVTDNALLGNLGPRV
FT                   PVQFQLIGNVTSDVTKEIKPFGINNALIEVDIHVSVDIQVVIPFATKAATVSTDIPIAM
FT                   QVIQGEVPEFYNDGGNVNPSFKVPSQ"
     ttgccaagat ttcccgcgcg tttgagaaaa ggtccgcttc ccttgcgata cgtgtttttg        60
     ctgacatttg ttttctttat gtttgcgact gcggtaagcc tttggattgt gaacaaagcg       120
     attgagccgg ttttaatgga aattgctgaa aaagaaacaa aacgaattgc caatttagtc       180
     attaataatg cgattgaaca gcagttttta aaagaaaata cggaaatgag cgatttaatt       240
     acagtacaga aggacgaaag cggcaaaatt gcttcggtag attttaatac agctgttgtc       300
     aaccggattt tggcaaagac agacgattat gtcatgcaaa gtttaaaagc ggcgacggaa       360
     ggcaaaatcg cagagcttga atttcctgat gataaatcgg aaaaagagaa aaataacgga       420
     attatttatt atattccgat tggccaagtt acagataatg cgcttcttgg caatcttggg       480
     ccgcgtgtcc ctgttcagtt ccagctcatc ggcaatgtta catcagatgt aacaaaagaa       540
     atcaagccgt ttggaattaa taacgcatta attgaagtgg acattcacgt ttccgtagat       600
     attcaagtgg tgattccatt cgcgacaaaa gcggcaaccg tttcgacgga tattccaatc       660
     gcgatgcagg tgattcaagg cgaagtccca gaattttata atgatggtgg aaatgtcaat       720
     ccgtctttta aagttccttc acaatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page