(data stored in ACNUC7421 zone)

EMBL: CP002293.PE497

CP002293.PE497       Location/Qualifiers
FT   CDS_pept        556226..556501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0521"
FT                   /product="protein of unknown function DUF1027"
FT                   /note="PFAM: protein of unknown function DUF1027; KEGG:
FT                   gwc:GWCH70_2904 protein of unknown function DUF1027"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73353"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV2"
FT                   /inference="protein motif:PFAM:PF06265"
FT                   /protein_id="ADP73353.1"
FT                   /translation="MICINNICYELVENVKNAFNEEAFRARYADILSKYDYIVGDWGYN
FT                   QLRLRGFFDDHNQRATYDTKISTLSEYLYEYCNFGCAYFVLRKVKR"
     atgatatgca ttaataatat atgttatgaa ttagtggaaa acgtgaaaaa cgcgtttaat        60
     gaagaagcat ttcgcgcgcg atatgccgat attttaagca agtatgacta tatcgtcggg       120
     gactggggct ataaccagct tcgcttgcgc ggtttttttg acgatcataa ccaacgggcg       180
     acatatgata cgaaaatcag cacattatca gaatatttgt atgaatattg caattttggc       240
     tgcgcgtatt ttgtgctccg caaagtgaaa cggtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page