(data stored in ACNUC7421 zone)

EMBL: CP002293.PE499

CP002293.PE499       Location/Qualifiers
FT   CDS_pept        complement(556909..557178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0523"
FT                   /product="Protein of unknown function DUF3055"
FT                   /note="PFAM: Protein of unknown function DUF3055; KEGG:
FT                   gwc:GWCH70_2902 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73355"
FT                   /db_xref="InterPro:IPR021415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV4"
FT                   /inference="protein motif:PFAM:PF11256"
FT                   /protein_id="ADP73355.1"
FT                   /translation="MSERFYLYDDTVDTKTRFVSFLGERQRFDLAIIETDRFYGKYLVL
FT                   DLQSNRFAIIGQDDLEEPGYLEEAYRLSEEDANDLRSFLYECIS"
     atgagcgaac gtttttactt atatgacgat acggtggata cgaaaacgcg ttttgtcagc        60
     tttcttggag aacggcaacg gtttgatttg gcaattatcg aaacggaccg cttttatggg       120
     aaatatttag ttctcgactt gcaaagcaac cgttttgcga ttattgggca ggacgattta       180
     gaagagccgg gatatttaga ggaagcttac cgcctgagtg aagaggatgc caatgattta       240
     cggtcatttt tatacgaatg catttcatag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page