(data stored in ACNUC7421 zone)

EMBL: CP002293.PE50

CP002293.PE50        Location/Qualifiers
FT   CDS_pept        59627..59857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0050"
FT                   /product="Uncharacterized protein family YabK"
FT                   /note="PFAM: Uncharacterised protein family YabK; KEGG:
FT                   gwc:GWCH70_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72906"
FT                   /db_xref="GOA:A0A0F6BHK5"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK5"
FT                   /inference="protein motif:PFAM:PF10955"
FT                   /protein_id="ADP72906.1"
FT                   /translation="MALHYYCRHCGTKVGTIDRVSIYSEQLGFHHLTEEERLEMIAYQP
FT                   NGDIHIKTICEDCQEALARNPELHQYEKFIH"
     atggcattgc attattattg tcggcattgt ggaacaaaag taggcacgat tgatagagtt        60
     tcgatctata gcgaacaatt gggatttcac catttgacag aggaagaacg tttggagatg       120
     attgcatacc agccaaatgg cgatattcac ataaaaacga tttgcgaaga ttgccaagag       180
     gcgttagcga gaaatcctga actgcatcag tatgaaaagt ttatacatta g                231
//

If you have problems or comments...

PBIL Back to PBIL home page