(data stored in ACNUC7421 zone)

EMBL: CP002293.PE500

CP002293.PE500       Location/Qualifiers
FT   CDS_pept        557279..557716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0524"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   gwc:GWCH70_2901 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73356"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV5"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADP73356.1"
FT                   /translation="MYFVDRNKIEETLRYMEKLLHIYKQKPSWDDELSQLALERLVHLV
FT                   IEAVLDVGNAMIDGFIMRDPGSYEDIIDILTDERVVTADDAKGLKAIIGYRKMLVHHYT
FT                   NVDHAKLLEEMQKHFPALQAYPNAIRTYLENELGPVSAFRN"
     atgtactttg ttgaccgcaa taaaatcgaa gaaacgctgc gctatatgga aaaactgtta        60
     catatttaca agcaaaaacc gtcgtgggac gatgaattat cccagctcgc tcttgagcgc       120
     cttgttcatt tagtgattga ggcggtttta gatgtcggaa acgcgatgat cgacggcttt       180
     attatgagag acccgggcag ctatgaggat attatcgaca ttttgacaga tgaacgggtt       240
     gtcacggcgg atgacgcaaa aggattgaaa gcgatcattg gctatcgaaa aatgcttgtt       300
     catcattata cgaatgtcga ccacgcaaaa ttattggagg aaatgcaaaa acattttccg       360
     gcgctgcaag catatccgaa tgctattcgc acatatttgg aaaacgagct cggtcccgtg       420
     tcggcgttcc gcaattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page