(data stored in SCRATCH zone)

EMBL: CP002293.PE507

CP002293.PE507       Location/Qualifiers
FT   CDS_pept        564287..565201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0531"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: gwc:GWCH70_2894 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73363"
FT                   /db_xref="GOA:A0A0F6BIW2"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW2"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADP73363.1"
FT                   /translation="MKEDGMLRIVVPASTANLGPGFDSIGLAVSRYLTLEVRLADEWKF
FT                   VPRSSEVAAIPAGMDNLIYQVAAQVAQTYGCTLPSCFVDVYSNIPFTRGLGSSAAAVVA
FT                   GIELANELAGLSLSLEQKMRFASCYEGHPDNVGASLYGGLVIGSHRREETDVVHVPDVQ
FT                   LDLVAVIPSYELETEKARSVLPQMMAREDAVEASAVSNVLVAALLTKRWELAGKMMSCD
FT                   LFHQPYRKELVPQLSLVEKLAMQYGAFGVALSGAGPTILAFAEPGKGMELKEKLAPYFP
FT                   DCAVEWLTVEQKGSQVYKMSFEK"
     atgaaagaag atgggatgtt aagaatcgtc gttccggcaa gcacagcaaa tttagggcca        60
     ggttttgatt caattggtct tgccgtgtcc cgttacttga cacttgaagt caggctggca       120
     gacgagtgga agttcgttcc ccgttcttca gaagtcgcag cgatcccagc ggggatggac       180
     aatttaattt atcaagtagc agcgcaagtg gcacaaacat atggatgcac gttgccaagc       240
     tgtttcgtgg atgtatatag caatatcccg tttacgcgcg gattgggaag cagcgcagca       300
     gcagtggtag cgggaattga actggccaat gagctggctg gtctgtcgct ctcgctggag       360
     caaaaaatgc ggtttgccag ctgttatgaa gggcatccgg ataatgttgg cgcttcgtta       420
     tacggagggc tcgtcattgg cagccatcgc cgggaagaga cggatgtcgt gcatgttcca       480
     gatgtgcaat tggatttagt tgctgtcatt ccttcgtatg agctggagac agaaaaagcg       540
     cgcagcgttt taccgcagat gatggcgcga gaagatgccg tcgaggccag cgcagtcagc       600
     aacgtgttag tcgcggcatt gttgaccaaa agatgggaac ttgcgggaaa aatgatgtcg       660
     tgcgatttat ttcatcagcc atatcgcaaa gaacttgttc cgcaattatc gcttgttgaa       720
     aagctggcta tgcaatatgg agcgtttggg gtggcattga gcggggctgg accgaccatt       780
     ctcgcttttg ccgaaccggg aaaagggatg gaattaaaag aaaaattagc cccatatttt       840
     ccggattgcg cggtagaatg gctaacggtc gaacaaaaag gaagtcaagt gtataaaatg       900
     tcgtttgaaa aataa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page