(data stored in ACNUC7421 zone)

EMBL: CP002293.PE508

CP002293.PE508       Location/Qualifiers
FT   CDS_pept        complement(565252..565488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0532"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   gwc:GWCH70_2893 nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73364"
FT                   /db_xref="GOA:A0A0F6BIW3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW3"
FT                   /inference="protein motif:PFAM:PF01106"
FT                   /protein_id="ADP73364.1"
FT                   /translation="MSDQEIKEQVQEVLDKLRPFLLRDGGDCELIDVEDGVVKLRLLGA
FT                   CGSCPSSTITLKAGIERALLEEVPGIVEVEQVF"
     atgagtgatc aagaaattaa agaacaagtg caagaagttc ttgacaaact gcgcccgttt        60
     ttgcttcgtg acggcgggga ctgcgaattg atcgacgttg aagacggagt tgtcaaattg       120
     cgtttgcttg gcgcatgcgg aagctgccca agctcgacga tcacattaaa agccggaatc       180
     gaacgcgcgc ttttggaaga agttccgggc attgtcgaag tagaacaagt attctaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page