(data stored in ACNUC7421 zone)

EMBL: CP002293.PE509

CP002293.PE509       Location/Qualifiers
FT   CDS_pept        565585..565911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0533"
FT                   /product="Uncharacterized conserved protein UCP010603"
FT                   /note="PFAM: Uncharacterised conserved protein UCP010603;
FT                   KEGG: gwc:GWCH70_2892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73365"
FT                   /db_xref="InterPro:IPR009190"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW4"
FT                   /inference="protein motif:PFAM:PF07315"
FT                   /protein_id="ADP73365.1"
FT                   /translation="MTLKQVEICVYGADMICPSCVHLPSSKETYEWLEAAIKRKYPNQP
FT                   FSITYIDIFNPPEDDEAKKAFAKKVLEEDLFYPVVVIEGVIVGEGNPRLKSIYAEMEKY
FT                   GYRG"
     atgacgctga agcaagtaga aatatgcgta tatggcgctg atatgatttg cccgtcttgt        60
     gtccatttgc cttcttccaa agaaacatat gaatggctgg aagcggcgat taaacggaaa       120
     tacccgaatc agccgttttc cataacatat attgatattt tcaacccgcc agaagatgac       180
     gaagcgaaaa aggcgtttgc caaaaaggtg ctggaagaag atttgtttta ccctgttgtt       240
     gtgatcgagg gggttatcgt tggagaagga aacccaaggt taaagtcgat ttatgcagag       300
     atggaaaagt acggttaccg gggataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page