(data stored in ACNUC7421 zone)

EMBL: CP002293.PE511

CP002293.PE511       Location/Qualifiers
FT   CDS_pept        complement(566469..567539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0535"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2891 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73367"
FT                   /db_xref="GOA:A0A0F6BIW6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73367.1"
FT                   /translation="MRHLVLLGGGYGNMRILLRLLPNHLPEDVHITLVDRVPYHCLKTE
FT                   YYALAAGTISDHHIRVPFPEHPRLTYRFGEVVNIDLDNQNVQLQDESSIPYDDLVIGLG
FT                   CEDKYHGVPGAETFTHSIQSIEKARAAYEALNNLPPGSIVGIVGAGLSGVELASELAES
FT                   RPDLHIKLFDRGERILPMFPKRLSNYVESWFHQHDIEIVRCSNITKVEERTLYNHDTPV
FT                   HCDVIVWTAGIQPNRVVRQLPVEKDKQGRVVLTKRHHIPGYENVYVVGDCASLPHSPSA
FT                   QLAEGQAEQIVQVLQKRWNGEEPPSEFPPIKLKGILGSLGRKHGFGLLADRPITGRVPR
FT                   LLKSGILWMYKYHNGY"
     atgagacacc ttgtgttgct cggcggagga tatggaaata tgcggatttt gcttcgcctc        60
     ctcccaaacc atttaccaga agatgttcat ataacgctcg tcgaccgtgt tccatatcat       120
     tgcttaaaaa cagagtatta tgcgctcgca gcaggcacga ttagcgatca ccacatccgc       180
     gtcccatttc ctgaacatcc gcgtcttacc taccgtttcg gtgaagtcgt taacatcgac       240
     cttgataatc aaaacgtgca gttgcaggat gaaagcagca tcccatatga tgatttagta       300
     atcggtttag gctgtgaaga taaataccat ggtgttccag gcgccgaaac tttcacgcat       360
     agcattcaat ccattgaaaa ggcgcgcgcg gcatatgaag cgttaaacaa tttgcctccc       420
     ggatctattg tcggcattgt cggcgcggga ctaagcggcg tcgaattggc aagtgaatta       480
     gcggaaagcc gtcctgattt acacataaaa ttgtttgatc gcggagaacg cattttgccg       540
     atgtttccta aacggctcag caactatgtc gaaagctggt ttcaccaaca tgatatcgaa       600
     attgtccgct gttccaacat tacgaaagta gaagaacgca cgctttacaa tcacgacacc       660
     ccagttcatt gcgatgtcat tgtctggaca gcaggcattc agccgaaccg cgtcgttcgc       720
     cagctgcctg tggaaaaaga caaacaaggc cgtgtcgttt taacgaaacg ccatcacatt       780
     cccggatatg aaaacgtata cgtcgtcggc gactgtgcaa gtttgccgca ctctccaagc       840
     gctcagctcg cagagggcca agcggaacaa atcgttcaag tattgcaaaa acgctggaac       900
     ggggaagaac cgccaagcga atttcctcct ataaaattaa aagggattct cggatcgctc       960
     ggccgaaaac acggattcgg cctccttgct gaccgcccaa taaccggaag agttccgcga      1020
     ttgttaaaat ccgggatatt gtggatgtac aaatatcata acggctacta a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page