(data stored in ACNUC7421 zone)

EMBL: CP002293.PE513

CP002293.PE513       Location/Qualifiers
FT   CDS_pept        567854..568093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2889 protein of unknown function
FT                   DUF1450"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73369"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR022916"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2889"
FT                   /protein_id="ADP73369.1"
FT                   /translation="MIQPIIEFCISNLANGSQKALEILEKDPNLDIIEYSCLSYCTRCA
FT                   ETLFALVNGEIVTGDTPEQLVENIYRYLEENPMF"
     atgatccagc caattattga attttgtatc agcaatttag caaacggctc gcaaaaggcg        60
     ttggaaatat tagaaaaaga tccgaacttg gatattatag aatatagttg tttaagctac       120
     tgcactcggt gtgcggaaac cctttttgct ttagtgaacg gggaaatcgt aaccggtgat       180
     actcctgagc agctggtgga aaatatttac cgttatttag aagaaaaccc gatgttttaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page