(data stored in ACNUC7421 zone)

EMBL: CP002293.PE516

CP002293.PE516       Location/Qualifiers
FT   CDS_pept        complement(569997..570989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0540"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2885 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73372"
FT                   /db_xref="GOA:A0A0F6BIX1"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73372.1"
FT                   /translation="MKEDPKIYDVTIIGGGPTGLFAAFYGGLRQMSVKIIESLPQLGGQ
FT                   LSALYPEKYIYDIAGFPKIRAQELINNLKEQMEQFAPTVCLEQSVEKLEKLENGTLKLT
FT                   TNKEIHYSKTVVITAGNGAFQPRRLELETAAQYEGKNLYYFINDLNQFKGQKVLVCGGG
FT                   DSAVDWSLMLEPIAEKVTIVHRRDKFRAHEHSVETLLNSTVNVKTPFVPVELIGDENGI
FT                   RQVVIEHVKDGSRETIDIDALIVNYGFISSLGPIKNWGLEIEKNSIKVNSKMETNIPGV
FT                   YAAGDICTYEGKIKLIACGFGEAPIAISSAKTYIDPTARMQPAHSTSLF"
     atgaaagagg atccaaaaat atatgatgtt actattatag gaggtggacc gaccgggctg        60
     tttgctgctt tttacggagg attaaggcag atgagcgtga aaattatcga aagccttccg       120
     caacttggcg gacaattatc tgcactttat cctgaaaagt acatatacga cattgccgga       180
     tttccaaaaa ttcgcgccca agaattgatt aataatttaa aagaacagat ggaacaattt       240
     gcgccgacgg tttgtttgga acagtcggtt gaaaagttag aaaaattaga aaacgggacg       300
     ttgaaattaa cgaccaacaa agaaatacac tattccaaaa ccgtcgttat taccgccgga       360
     aacggcgctt tccagccgcg gcgccttgag ctagaaaccg cggcgcaata tgaagggaaa       420
     aatttatatt acttcattaa cgacttaaac caatttaaag ggcaaaaagt gctcgtctgt       480
     ggtggcgggg attcagccgt tgactggtcg cttatgctgg aaccgatcgc ggaaaaagta       540
     acgattgtgc atcggcgcga taaattccgc gctcatgaac atagcgtgga aacattgctg       600
     aattccaccg ttaatgttaa aacccctttc gttcctgtgg agttaatcgg cgatgaaaac       660
     gggatccgcc aagtcgtcat cgagcacgtg aaagacggct cccgcgaaac gatcgacatc       720
     gacgcgctca ttgtgaatta cggctttatt tcttcgcttg gaccaataaa aaactggggg       780
     ctggaaattg agaaaaactc gatcaaagtc aactcgaaaa tggaaacaaa cattcctggc       840
     gtttacgctg ccggcgatat atgcacatat gaaggaaaaa taaagctcat tgcttgcgga       900
     ttcggggaag cgccaatcgc gattagcagc gccaaaacgt atatcgatcc gacagcgaga       960
     atgcaaccgg cgcactccac ttcactcttc taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page