(data stored in SCRATCH zone)

EMBL: CP002293.PE520

CP002293.PE520       Location/Qualifiers
FT   CDS_pept        573534..573857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73376"
FT                   /db_xref="GOA:A0A0F6BIX5"
FT                   /db_xref="InterPro:IPR025917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX5"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2881"
FT                   /protein_id="ADP73376.1"
FT                   /translation="MQMSLPVVLISMLLFFVLFFGIGFLLNMLLRMTWIMAVLCPIVFI
FT                   FIIDDIPWTKYFTDPVSSFVALKHKVLSLAPADILILASGFVGAVCAGFAIRTLRAKGY
FT                   QMF"
     atgcaaatga gcttgcctgt cgtgctcatt tccatgcttc tattttttgt tttatttttc        60
     ggcatcggct ttttattaaa tatgttgttg cgcatgactt ggattatggc ggttttatgc       120
     ccaattgtat ttatttttat tatcgatgat attccgtgga cgaaatattt tactgatccg       180
     gtgtcttcct ttgttgcact aaagcataaa gtgttatcac tggcgccggc ggacatttta       240
     attttagcta gcggatttgt cggggcagtt tgcgccgggt tcgccattcg cacgctgcgt       300
     gccaaaggat accaaatgtt ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page