(data stored in SCRATCH zone)

EMBL: CP002293.PE521

CP002293.PE521       Location/Qualifiers
FT   CDS_pept        573965..574669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0545"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   gwc:GWCH70_2880 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73377"
FT                   /db_xref="GOA:A0A0F6BIX6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX6"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73377.1"
FT                   /translation="MILLKNIVRRITMSLLFAMALLTTFQAISGVEAKVIVDKLYGVSS
FT                   FHTGYHFFDIWKEQQHVAIDAQWKYYEGRKKPQISSEKISQPPRLEEAIDWSKYPSKVV
FT                   VATGYTAGVESTGKTPNHPEYGITYSGVRVKRDLYSTIAADLNVFPIGTILFIPGYGYG
FT                   VVADKGGAIKGNRVDLYYDTVEDVYKYWGKKTVQVYIVKKGDGELSEEELKQLNENETM
FT                   QVFRQQYLQSKS"
     atgattcttc ttaaaaatat agtaagaaga ataacaatgt cattattgtt cgcaatggcg        60
     ctattgacaa cttttcaagc gatttcagga gtcgaagcga aagtgattgt ggacaaattg       120
     tatggtgtgt cgtcatttca tacgggctat cacttttttg acatatggaa agaacagcaa       180
     catgttgcga tagatgcaca atggaagtat tacgagggga ggaaaaaacc gcaaatttcc       240
     tcggaaaaga taagtcagcc gccccgcctt gaagaagcga ttgattggtc aaaatatcca       300
     tctaaagttg ttgttgcgac aggatataca gcaggagtgg agtcgacagg aaaaacgccg       360
     aatcatccgg agtatgggat aacatattct ggagtgcgtg tgaaacgtga cttatattca       420
     acgattgccg cggatttaaa tgtcttccca atcggtacca ttctttttat ccctggatat       480
     ggatatgggg tcgtggccga taaaggaggg gcgataaaag gcaatcgcgt cgatttatat       540
     tatgatacgg ttgaggatgt atataaatac tgggggaaaa agactgtgca agtgtatatt       600
     gtgaaaaagg gagatggaga gctttccgaa gaagaattaa agcagctgaa tgaaaatgaa       660
     acgatgcaag tgtttaggca gcaatatttg caatcgaaaa gctaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page